Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2471235..2471873 | Replicon | chromosome |
Accession | NZ_CP098201 | ||
Organism | Escherichia coli strain Z0117EC0056 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A7U9DHD1 |
Locus tag | NBY20_RS11960 | Protein ID | WP_000813795.1 |
Coordinates | 2471235..2471411 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NBY20_RS11965 | Protein ID | WP_076797675.1 |
Coordinates | 2471457..2471873 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY20_RS11940 (2466857) | 2466857..2468029 | - | 1173 | WP_001551088.1 | BenE family transporter YdcO | - |
NBY20_RS11945 (2468121) | 2468121..2468657 | + | 537 | WP_001551089.1 | DNA-binding transcriptional regulator SutR | - |
NBY20_RS11950 (2468730) | 2468730..2470691 | + | 1962 | WP_001551090.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
NBY20_RS11955 (2470783) | 2470783..2471013 | - | 231 | WP_023910283.1 | YncJ family protein | - |
NBY20_RS11960 (2471235) | 2471235..2471411 | + | 177 | WP_000813795.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
NBY20_RS11965 (2471457) | 2471457..2471873 | + | 417 | WP_076797675.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
NBY20_RS11970 (2471952) | 2471952..2473358 | + | 1407 | WP_001551093.1 | PLP-dependent aminotransferase family protein | - |
NBY20_RS11975 (2473603) | 2473603..2474748 | + | 1146 | WP_001551094.1 | ABC transporter substrate-binding protein | - |
NBY20_RS11980 (2474766) | 2474766..2475779 | + | 1014 | WP_001551095.1 | ABC transporter ATP-binding protein | - |
NBY20_RS11985 (2475780) | 2475780..2476721 | + | 942 | WP_001251315.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6747.80 Da Isoelectric Point: 11.5666
>T247011 WP_000813795.1 NZ_CP098201:2471235-2471411 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPSEEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15220.55 Da Isoelectric Point: 4.7386
>AT247011 WP_076797675.1 NZ_CP098201:2471457-2471873 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPSNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPSNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|