Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2040576..2041360 | Replicon | chromosome |
Accession | NZ_CP098201 | ||
Organism | Escherichia coli strain Z0117EC0056 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | V0T0H9 |
Locus tag | NBY20_RS09690 | Protein ID | WP_000613626.1 |
Coordinates | 2040576..2041070 (-) | Length | 165 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | L4JCW6 |
Locus tag | NBY20_RS09695 | Protein ID | WP_001110447.1 |
Coordinates | 2041067..2041360 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY20_RS09670 (2035769) | 2035769..2036866 | + | 1098 | WP_001441925.1 | flagellar basal body P-ring protein FlgI | - |
NBY20_RS09675 (2036866) | 2036866..2037807 | + | 942 | WP_001366226.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
NBY20_RS09680 (2037873) | 2037873..2039516 | + | 1644 | WP_000096478.1 | flagellar hook-associated protein FlgK | - |
NBY20_RS09685 (2039528) | 2039528..2040481 | + | 954 | WP_001212768.1 | flagellar hook-associated protein FlgL | - |
NBY20_RS09690 (2040576) | 2040576..2041070 | - | 495 | WP_000613626.1 | GNAT family N-acetyltransferase | Toxin |
NBY20_RS09695 (2041067) | 2041067..2041360 | - | 294 | WP_001110447.1 | DUF1778 domain-containing protein | Antitoxin |
NBY20_RS09700 (2041493) | 2041493..2044678 | - | 3186 | WP_001550951.1 | ribonuclease E | - |
NBY20_RS09705 (2045251) | 2045251..2046210 | + | 960 | WP_000846342.1 | 23S rRNA pseudouridine(955/2504/2580) synthase RluC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 18084.00 Da Isoelectric Point: 8.2617
>T247007 WP_000613626.1 NZ_CP098201:c2041070-2040576 [Escherichia coli]
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|