Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1383343..1383961 | Replicon | chromosome |
Accession | NZ_CP098201 | ||
Organism | Escherichia coli strain Z0117EC0056 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | NBY20_RS06705 | Protein ID | WP_001291435.1 |
Coordinates | 1383343..1383561 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | NBY20_RS06710 | Protein ID | WP_000344800.1 |
Coordinates | 1383587..1383961 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY20_RS06670 (1378632) | 1378632..1379204 | + | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
NBY20_RS06675 (1379235) | 1379235..1379546 | - | 312 | WP_000409911.1 | MGMT family protein | - |
NBY20_RS06685 (1379925) | 1379925..1380278 | + | 354 | WP_001550741.1 | DUF1428 family protein | - |
NBY20_RS06690 (1380320) | 1380320..1381870 | - | 1551 | WP_001366446.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
NBY20_RS06695 (1382034) | 1382034..1382504 | - | 471 | WP_000136192.1 | YlaC family protein | - |
NBY20_RS06700 (1382620) | 1382620..1383171 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
NBY20_RS06705 (1383343) | 1383343..1383561 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
NBY20_RS06710 (1383587) | 1383587..1383961 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
NBY20_RS06715 (1384507) | 1384507..1387656 | - | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
NBY20_RS06720 (1387679) | 1387679..1388872 | - | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T247005 WP_001291435.1 NZ_CP098201:c1383561-1383343 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT247005 WP_000344800.1 NZ_CP098201:c1383961-1383587 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |