246994

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 64442..65043 Replicon plasmid pZ0117EC0062-2
Accession NZ_CP098199
Organism Escherichia coli strain Z0117EC0062

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag NBY21_RS24720 Protein ID WP_001216034.1
Coordinates 64442..64822 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag NBY21_RS24725 Protein ID WP_001190712.1
Coordinates 64822..65043 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY21_RS24695 (NBY21_24700) 59883..61325 - 1443 WP_001472843.1 hypothetical protein -
NBY21_RS24700 (NBY21_24705) 61367..62560 - 1194 WP_000219625.1 hypothetical protein -
NBY21_RS24705 (NBY21_24710) 62646..63098 - 453 WP_001326849.1 late promoter-activating protein -
NBY21_RS24710 (NBY21_24715) 63187..64230 - 1044 WP_023356283.1 DUF968 domain-containing protein -
NBY21_RS24715 (NBY21_24720) 64258..64437 - 180 WP_001339207.1 hypothetical protein -
NBY21_RS24720 (NBY21_24725) 64442..64822 - 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NBY21_RS24725 (NBY21_24730) 64822..65043 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NBY21_RS24730 (NBY21_24735) 65116..65505 - 390 WP_053273048.1 S24 family peptidase -
NBY21_RS24735 (NBY21_24740) 65680..66264 + 585 WP_053273047.1 hypothetical protein -
NBY21_RS24740 (NBY21_24745) 66265..66627 + 363 WP_053273046.1 hypothetical protein -
NBY21_RS24745 (NBY21_24750) 66639..66878 - 240 WP_053273045.1 DNA polymerase III subunit theta -
NBY21_RS24750 (NBY21_24755) 67193..67828 - 636 WP_053273044.1 hypothetical protein -
NBY21_RS24755 (NBY21_24760) 67810..68184 - 375 WP_000988655.1 hypothetical protein -
NBY21_RS24760 (NBY21_24765) 68191..68484 - 294 WP_001677496.1 hypothetical protein -
NBY21_RS24765 (NBY21_24770) 68663..68896 - 234 WP_000517420.1 hypothetical protein -
NBY21_RS24770 (NBY21_24775) 68973..69233 - 261 WP_028120198.1 hypothetical protein -
NBY21_RS24775 (NBY21_24780) 69230..69928 - 699 WP_053273042.1 DUF551 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..92797 92797


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T246994 WP_001216034.1 NZ_CP098199:c64822-64442 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT246994 WP_001190712.1 NZ_CP098199:c65043-64822 [Escherichia coli]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References