Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 64442..65043 | Replicon | plasmid pZ0117EC0062-2 |
| Accession | NZ_CP098199 | ||
| Organism | Escherichia coli strain Z0117EC0062 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | V0AJ64 |
| Locus tag | NBY21_RS24720 | Protein ID | WP_001216034.1 |
| Coordinates | 64442..64822 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | NBY21_RS24725 | Protein ID | WP_001190712.1 |
| Coordinates | 64822..65043 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY21_RS24695 (NBY21_24700) | 59883..61325 | - | 1443 | WP_001472843.1 | hypothetical protein | - |
| NBY21_RS24700 (NBY21_24705) | 61367..62560 | - | 1194 | WP_000219625.1 | hypothetical protein | - |
| NBY21_RS24705 (NBY21_24710) | 62646..63098 | - | 453 | WP_001326849.1 | late promoter-activating protein | - |
| NBY21_RS24710 (NBY21_24715) | 63187..64230 | - | 1044 | WP_023356283.1 | DUF968 domain-containing protein | - |
| NBY21_RS24715 (NBY21_24720) | 64258..64437 | - | 180 | WP_001339207.1 | hypothetical protein | - |
| NBY21_RS24720 (NBY21_24725) | 64442..64822 | - | 381 | WP_001216034.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| NBY21_RS24725 (NBY21_24730) | 64822..65043 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NBY21_RS24730 (NBY21_24735) | 65116..65505 | - | 390 | WP_053273048.1 | S24 family peptidase | - |
| NBY21_RS24735 (NBY21_24740) | 65680..66264 | + | 585 | WP_053273047.1 | hypothetical protein | - |
| NBY21_RS24740 (NBY21_24745) | 66265..66627 | + | 363 | WP_053273046.1 | hypothetical protein | - |
| NBY21_RS24745 (NBY21_24750) | 66639..66878 | - | 240 | WP_053273045.1 | DNA polymerase III subunit theta | - |
| NBY21_RS24750 (NBY21_24755) | 67193..67828 | - | 636 | WP_053273044.1 | hypothetical protein | - |
| NBY21_RS24755 (NBY21_24760) | 67810..68184 | - | 375 | WP_000988655.1 | hypothetical protein | - |
| NBY21_RS24760 (NBY21_24765) | 68191..68484 | - | 294 | WP_001677496.1 | hypothetical protein | - |
| NBY21_RS24765 (NBY21_24770) | 68663..68896 | - | 234 | WP_000517420.1 | hypothetical protein | - |
| NBY21_RS24770 (NBY21_24775) | 68973..69233 | - | 261 | WP_028120198.1 | hypothetical protein | - |
| NBY21_RS24775 (NBY21_24780) | 69230..69928 | - | 699 | WP_053273042.1 | DUF551 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..92797 | 92797 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13615.32 Da Isoelectric Point: 5.1514
>T246994 WP_001216034.1 NZ_CP098199:c64822-64442 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0AJ64 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJB6 |