Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 3297725..3298430 | Replicon | chromosome |
Accession | NZ_CP098197 | ||
Organism | Escherichia coli strain Z0117EC0062 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1F406 |
Locus tag | NBY21_RS15920 | Protein ID | WP_000539521.1 |
Coordinates | 3297725..3298111 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | NBY21_RS15925 | Protein ID | WP_001280945.1 |
Coordinates | 3298101..3298430 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY21_RS15900 (3293729) | 3293729..3294355 | + | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
NBY21_RS15905 (3294352) | 3294352..3295467 | - | 1116 | WP_000555051.1 | aldose sugar dehydrogenase YliI | - |
NBY21_RS15910 (3295578) | 3295578..3295961 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
NBY21_RS15915 (3296174) | 3296174..3297499 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
NBY21_RS15920 (3297725) | 3297725..3298111 | + | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NBY21_RS15925 (3298101) | 3298101..3298430 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
NBY21_RS15930 (3298500) | 3298500..3299828 | - | 1329 | WP_001550887.1 | GGDEF domain-containing protein | - |
NBY21_RS15935 (3299836) | 3299836..3302184 | - | 2349 | WP_001550886.1 | EAL domain-containing protein | - |
NBY21_RS15940 (3302362) | 3302362..3303273 | - | 912 | Protein_3125 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T246977 WP_000539521.1 NZ_CP098197:3297725-3298111 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|