Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 3041621..3042405 | Replicon | chromosome |
| Accession | NZ_CP098197 | ||
| Organism | Escherichia coli strain Z0117EC0062 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | V0T0H9 |
| Locus tag | NBY21_RS14705 | Protein ID | WP_000613626.1 |
| Coordinates | 3041911..3042405 (+) | Length | 165 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | L4JCW6 |
| Locus tag | NBY21_RS14700 | Protein ID | WP_001110447.1 |
| Coordinates | 3041621..3041914 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY21_RS14690 (3036771) | 3036771..3037730 | - | 960 | WP_000846342.1 | 23S rRNA pseudouridine(955/2504/2580) synthase RluC | - |
| NBY21_RS14695 (3038303) | 3038303..3041488 | + | 3186 | WP_001550951.1 | ribonuclease E | - |
| NBY21_RS14700 (3041621) | 3041621..3041914 | + | 294 | WP_001110447.1 | DUF1778 domain-containing protein | Antitoxin |
| NBY21_RS14705 (3041911) | 3041911..3042405 | + | 495 | WP_000613626.1 | GNAT family N-acetyltransferase | Toxin |
| NBY21_RS14710 (3042500) | 3042500..3043453 | - | 954 | WP_001212768.1 | flagellar hook-associated protein FlgL | - |
| NBY21_RS14715 (3043465) | 3043465..3045108 | - | 1644 | WP_000096478.1 | flagellar hook-associated protein FlgK | - |
| NBY21_RS14720 (3045174) | 3045174..3046115 | - | 942 | WP_001366226.1 | flagellar assembly peptidoglycan hydrolase FlgJ | - |
| NBY21_RS14725 (3046115) | 3046115..3047212 | - | 1098 | WP_001441925.1 | flagellar basal body P-ring protein FlgI | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 165 a.a. Molecular weight: 18084.00 Da Isoelectric Point: 8.2617
>T246976 WP_000613626.1 NZ_CP098197:3041911-3042405 [Escherichia coli]
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
MIQAPEPLMARHQFTSFCSGVETMDNWLKQRALKNQLAGASRTFVSCDTYSNVLAYYSLASSAVETYVATGRFRRNMPEP
IPVVVLGRLAIDKSLQGQGIGRAMVRDAGLRVLQAAEVIGIRGMLVHALSDQAREFYLRVGFEPSPVDSMILMATLADLQ
ECLK
Download Length: 495 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|