Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 1046035..1046689 | Replicon | chromosome |
Accession | NZ_CP098197 | ||
Organism | Escherichia coli strain Z0117EC0062 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1EEB2 |
Locus tag | NBY21_RS05155 | Protein ID | WP_000244777.1 |
Coordinates | 1046282..1046689 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | NBY21_RS05150 | Protein ID | WP_000354046.1 |
Coordinates | 1046035..1046301 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY21_RS05125 (1041204) | 1041204..1041947 | + | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
NBY21_RS05130 (1042004) | 1042004..1043437 | - | 1434 | WP_001336277.1 | 6-phospho-beta-glucosidase BglA | - |
NBY21_RS05135 (1043482) | 1043482..1043793 | + | 312 | WP_001182966.1 | N(4)-acetylcytidine aminohydrolase | - |
NBY21_RS05140 (1043957) | 1043957..1044616 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
NBY21_RS05145 (1044812) | 1044812..1045792 | - | 981 | WP_000886083.1 | tRNA-modifying protein YgfZ | - |
NBY21_RS05150 (1046035) | 1046035..1046301 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
NBY21_RS05155 (1046282) | 1046282..1046689 | + | 408 | WP_000244777.1 | protein YgfX | Toxin |
NBY21_RS05160 (1046729) | 1046729..1047250 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
NBY21_RS05165 (1047362) | 1047362..1048258 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
NBY21_RS05170 (1048283) | 1048283..1048993 | + | 711 | WP_001564005.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NBY21_RS05175 (1048999) | 1048999..1050732 | + | 1734 | WP_001564004.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T246967 WP_000244777.1 NZ_CP098197:1046282-1046689 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LFV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |