Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 912895..913730 Replicon chromosome
Accession NZ_CP098197
Organism Escherichia coli strain Z0117EC0062

Toxin (Protein)


Gene name yeeV Uniprot ID A0A0A1A9A5
Locus tag NBY21_RS04455 Protein ID WP_001564063.1
Coordinates 912895..913272 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A0A1AEL8
Locus tag NBY21_RS04460 Protein ID WP_038432125.1
Coordinates 913362..913730 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY21_RS04425 (908023) 908023..909171 - 1149 WP_000905920.1 capsule polysaccharide export inner-membrane protein KpsE -
NBY21_RS04430 (909243) 909243..910226 - 984 WP_001361242.1 KpsF/GutQ family sugar-phosphate isomerase -
NBY21_RS04435 (911037) 911037..911207 - 171 Protein_860 IS110 family transposase -
NBY21_RS04440 (911549) 911549..912391 - 843 Protein_861 DUF4942 domain-containing protein -
NBY21_RS04445 (912476) 912476..912670 - 195 WP_024181941.1 DUF957 domain-containing protein -
NBY21_RS04450 (912749) 912749..912898 - 150 Protein_863 DUF5983 family protein -
NBY21_RS04455 (912895) 912895..913272 - 378 WP_001564063.1 TA system toxin CbtA family protein Toxin
NBY21_RS04460 (913362) 913362..913730 - 369 WP_038432125.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NBY21_RS04465 (913893) 913893..914114 - 222 WP_000692345.1 DUF987 domain-containing protein -
NBY21_RS04470 (914179) 914179..914655 - 477 WP_021553055.1 RadC family protein -
NBY21_RS04475 (914671) 914671..915150 - 480 WP_001564060.1 antirestriction protein -
NBY21_RS04480 (915416) 915416..916234 - 819 WP_001175165.1 DUF932 domain-containing protein -
NBY21_RS04485 (916324) 916324..916557 - 234 WP_001278293.1 DUF905 family protein -
NBY21_RS04490 (916563) 916563..917240 - 678 WP_001564058.1 hypothetical protein -
NBY21_RS04495 (917391) 917391..918071 - 681 WP_001278649.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - papX 911422..976683 65261
- flank IS/Tn - - 911037..911141 104


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14094.09 Da        Isoelectric Point: 7.8045

>T246966 WP_001564063.1 NZ_CP098197:c913272-912895 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13569.31 Da        Isoelectric Point: 7.0369

>AT246966 WP_038432125.1 NZ_CP098197:c913730-913362 [Escherichia coli]
VSDTLSGTTHPDDNHDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGNRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSGGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0A1A9A5

Antitoxin

Source ID Structure
AlphaFold DB A0A0A1AEL8

References