Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 912895..913730 | Replicon | chromosome |
| Accession | NZ_CP098197 | ||
| Organism | Escherichia coli strain Z0117EC0062 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0A1A9A5 |
| Locus tag | NBY21_RS04455 | Protein ID | WP_001564063.1 |
| Coordinates | 912895..913272 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A0A1AEL8 |
| Locus tag | NBY21_RS04460 | Protein ID | WP_038432125.1 |
| Coordinates | 913362..913730 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY21_RS04425 (908023) | 908023..909171 | - | 1149 | WP_000905920.1 | capsule polysaccharide export inner-membrane protein KpsE | - |
| NBY21_RS04430 (909243) | 909243..910226 | - | 984 | WP_001361242.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
| NBY21_RS04435 (911037) | 911037..911207 | - | 171 | Protein_860 | IS110 family transposase | - |
| NBY21_RS04440 (911549) | 911549..912391 | - | 843 | Protein_861 | DUF4942 domain-containing protein | - |
| NBY21_RS04445 (912476) | 912476..912670 | - | 195 | WP_024181941.1 | DUF957 domain-containing protein | - |
| NBY21_RS04450 (912749) | 912749..912898 | - | 150 | Protein_863 | DUF5983 family protein | - |
| NBY21_RS04455 (912895) | 912895..913272 | - | 378 | WP_001564063.1 | TA system toxin CbtA family protein | Toxin |
| NBY21_RS04460 (913362) | 913362..913730 | - | 369 | WP_038432125.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NBY21_RS04465 (913893) | 913893..914114 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| NBY21_RS04470 (914179) | 914179..914655 | - | 477 | WP_021553055.1 | RadC family protein | - |
| NBY21_RS04475 (914671) | 914671..915150 | - | 480 | WP_001564060.1 | antirestriction protein | - |
| NBY21_RS04480 (915416) | 915416..916234 | - | 819 | WP_001175165.1 | DUF932 domain-containing protein | - |
| NBY21_RS04485 (916324) | 916324..916557 | - | 234 | WP_001278293.1 | DUF905 family protein | - |
| NBY21_RS04490 (916563) | 916563..917240 | - | 678 | WP_001564058.1 | hypothetical protein | - |
| NBY21_RS04495 (917391) | 917391..918071 | - | 681 | WP_001278649.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | papX | 911422..976683 | 65261 | |
| - | flank | IS/Tn | - | - | 911037..911141 | 104 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14094.09 Da Isoelectric Point: 7.8045
>T246966 WP_001564063.1 NZ_CP098197:c913272-912895 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13569.31 Da Isoelectric Point: 7.0369
>AT246966 WP_038432125.1 NZ_CP098197:c913730-913362 [Escherichia coli]
VSDTLSGTTHPDDNHDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGNRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSGGYVYLAVYPTPETKK
VSDTLSGTTHPDDNHDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGNRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0A1A9A5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0A1AEL8 |