Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3825119..3825956 | Replicon | chromosome |
Accession | NZ_CP098195 | ||
Organism | Escherichia coli strain Z0117EC0098 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | NBY23_RS18890 | Protein ID | WP_000227784.1 |
Coordinates | 3825414..3825956 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | NBY23_RS18885 | Protein ID | WP_001297137.1 |
Coordinates | 3825119..3825430 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY23_RS18860 (3820139) | 3820139..3821086 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
NBY23_RS18865 (3821108) | 3821108..3823099 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
NBY23_RS18870 (3823089) | 3823089..3823703 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
NBY23_RS18875 (3823703) | 3823703..3824032 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
NBY23_RS18880 (3824044) | 3824044..3824934 | + | 891 | WP_000971336.1 | heme o synthase | - |
NBY23_RS18885 (3825119) | 3825119..3825430 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
NBY23_RS18890 (3825414) | 3825414..3825956 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
NBY23_RS18895 (3826012) | 3826012..3826946 | - | 935 | Protein_3711 | tetratricopeptide repeat protein | - |
NBY23_RS18900 (3827354) | 3827354..3828718 | + | 1365 | WP_001000978.1 | MFS transporter | - |
NBY23_RS18905 (3828846) | 3828846..3829337 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
NBY23_RS18910 (3829505) | 3829505..3830416 | + | 912 | WP_000705847.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T246955 WP_000227784.1 NZ_CP098195:3825414-3825956 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|