Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3791042..3791660 | Replicon | chromosome |
Accession | NZ_CP098195 | ||
Organism | Escherichia coli strain Z0117EC0098 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | NBY23_RS18720 | Protein ID | WP_001291435.1 |
Coordinates | 3791442..3791660 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | NBY23_RS18715 | Protein ID | WP_000344800.1 |
Coordinates | 3791042..3791416 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY23_RS18705 (3786131) | 3786131..3787324 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NBY23_RS18710 (3787347) | 3787347..3790496 | + | 3150 | WP_191650283.1 | efflux RND transporter permease AcrB | - |
NBY23_RS18715 (3791042) | 3791042..3791416 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
NBY23_RS18720 (3791442) | 3791442..3791660 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
NBY23_RS18725 (3791832) | 3791832..3792383 | + | 552 | WP_000102568.1 | maltose O-acetyltransferase | - |
NBY23_RS18730 (3792499) | 3792499..3792969 | + | 471 | WP_000136192.1 | YlaC family protein | - |
NBY23_RS18735 (3793133) | 3793133..3794683 | + | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
NBY23_RS18740 (3794725) | 3794725..3795078 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
NBY23_RS18750 (3795457) | 3795457..3795768 | + | 312 | WP_000409911.1 | MGMT family protein | - |
NBY23_RS18755 (3795799) | 3795799..3796371 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T246954 WP_001291435.1 NZ_CP098195:3791442-3791660 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT246954 WP_000344800.1 NZ_CP098195:3791042-3791416 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |