Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2454157..2454795 | Replicon | chromosome |
Accession | NZ_CP098195 | ||
Organism | Escherichia coli strain Z0117EC0098 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | NBY23_RS12280 | Protein ID | WP_000813794.1 |
Coordinates | 2454157..2454333 (+) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NBY23_RS12285 | Protein ID | WP_001270286.1 |
Coordinates | 2454379..2454795 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY23_RS12260 (2449776) | 2449776..2450951 | - | 1176 | WP_001236319.1 | BenE family transporter YdcO | - |
NBY23_RS12265 (2451043) | 2451043..2451579 | + | 537 | WP_000429141.1 | DNA-binding transcriptional regulator SutR | - |
NBY23_RS12270 (2451652) | 2451652..2453613 | + | 1962 | WP_001307191.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
NBY23_RS12275 (2453705) | 2453705..2453935 | - | 231 | WP_000494244.1 | YncJ family protein | - |
NBY23_RS12280 (2454157) | 2454157..2454333 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
NBY23_RS12285 (2454379) | 2454379..2454795 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
NBY23_RS12290 (2454874) | 2454874..2456280 | + | 1407 | WP_000760629.1 | PLP-dependent aminotransferase family protein | - |
NBY23_RS12295 (2456525) | 2456525..2457670 | + | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
NBY23_RS12300 (2457688) | 2457688..2458701 | + | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
NBY23_RS12305 (2458702) | 2458702..2459643 | + | 942 | WP_001251319.1 | ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T246947 WP_000813794.1 NZ_CP098195:2454157-2454333 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT246947 WP_001270286.1 NZ_CP098195:2454379-2454795 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|