Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 1198546..1199129 | Replicon | chromosome |
| Accession | NZ_CP098195 | ||
| Organism | Escherichia coli strain Z0117EC0098 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | U9XFN8 |
| Locus tag | NBY23_RS05935 | Protein ID | WP_000254745.1 |
| Coordinates | 1198794..1199129 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | S1P3W5 |
| Locus tag | NBY23_RS05930 | Protein ID | WP_000581937.1 |
| Coordinates | 1198546..1198794 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY23_RS05920 (1194885) | 1194885..1196186 | + | 1302 | WP_000046790.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
| NBY23_RS05925 (1196234) | 1196234..1198468 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
| NBY23_RS05930 (1198546) | 1198546..1198794 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| NBY23_RS05935 (1198794) | 1198794..1199129 | + | 336 | WP_000254745.1 | endoribonuclease MazF | Toxin |
| NBY23_RS05940 (1199200) | 1199200..1199991 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| NBY23_RS05945 (1200219) | 1200219..1201856 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
| NBY23_RS05950 (1201944) | 1201944..1203242 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
| NBY23_RS05955 (1203298) | 1203298..1203660 | - | 363 | WP_000034929.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12158.08 Da Isoelectric Point: 8.4777
>T246941 WP_000254745.1 NZ_CP098195:1198794-1199129 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPYTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPYTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XYM3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 1UB4 | |
| PDB | 5CQX | |
| PDB | 5CQY | |
| PDB | 1MVF | |
| PDB | 2MRN | |
| PDB | 2MRU | |
| AlphaFold DB | A0A7U9LMB4 |