Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 118241..118884 Replicon plasmid pZ0117ECO0116-1
Accession NZ_CP098193
Organism Escherichia coli strain Z0117EC0116

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag NBY24_RS24495 Protein ID WP_001034046.1
Coordinates 118468..118884 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag NBY24_RS24490 Protein ID WP_001261278.1
Coordinates 118241..118471 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY24_RS24460 (113753) 113753..114058 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB -
NBY24_RS24465 (114060) 114060..114278 - 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA -
NBY24_RS24470 (114868) 114868..115356 + 489 WP_011254646.1 hypothetical protein -
NBY24_RS24475 (115390) 115390..116523 - 1134 WP_000545987.1 DUF3800 domain-containing protein -
NBY24_RS24480 (116690) 116690..117463 - 774 WP_000905949.1 hypothetical protein -
NBY24_RS24485 (117476) 117476..117976 - 501 WP_000528932.1 HEPN family nuclease -
NBY24_RS24490 (118241) 118241..118471 + 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NBY24_RS24495 (118468) 118468..118884 + 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
NBY24_RS24500 (118929) 118929..122723 - 3795 WP_001144732.1 hypothetical protein -
NBY24_RS24505 (123104) 123104..123334 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
NBY24_RS24510 (123331) 123331..123747 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD vat / iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN 1..192025 192025


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T246931 WP_001034046.1 NZ_CP098193:118468-118884 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT246931 WP_001261278.1 NZ_CP098193:118241-118471 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References