Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 113753..114278 | Replicon | plasmid pZ0117ECO0116-1 |
| Accession | NZ_CP098193 | ||
| Organism | Escherichia coli strain Z0117EC0116 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | S1PFV8 |
| Locus tag | NBY24_RS24460 | Protein ID | WP_001159871.1 |
| Coordinates | 113753..114058 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | H9TJP1 |
| Locus tag | NBY24_RS24465 | Protein ID | WP_000813630.1 |
| Coordinates | 114060..114278 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY24_RS24445 (109709) | 109709..110914 | - | 1206 | WP_001442122.1 | AAA family ATPase | - |
| NBY24_RS24450 (111535) | 111535..112266 | + | 732 | WP_000504262.1 | replication initiation protein | - |
| NBY24_RS24455 (112946) | 112946..113752 | - | 807 | WP_000016968.1 | site-specific integrase | - |
| NBY24_RS24460 (113753) | 113753..114058 | - | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| NBY24_RS24465 (114060) | 114060..114278 | - | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| NBY24_RS24470 (114868) | 114868..115356 | + | 489 | WP_011254646.1 | hypothetical protein | - |
| NBY24_RS24475 (115390) | 115390..116523 | - | 1134 | WP_000545987.1 | DUF3800 domain-containing protein | - |
| NBY24_RS24480 (116690) | 116690..117463 | - | 774 | WP_000905949.1 | hypothetical protein | - |
| NBY24_RS24485 (117476) | 117476..117976 | - | 501 | WP_000528932.1 | HEPN family nuclease | - |
| NBY24_RS24490 (118241) | 118241..118471 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| NBY24_RS24495 (118468) | 118468..118884 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | vat / iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN | 1..192025 | 192025 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T246930 WP_001159871.1 NZ_CP098193:c114058-113753 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CCE8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CEF5 |