Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 113753..114278 Replicon plasmid pZ0117ECO0116-1
Accession NZ_CP098193
Organism Escherichia coli strain Z0117EC0116

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag NBY24_RS24460 Protein ID WP_001159871.1
Coordinates 113753..114058 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID H9TJP1
Locus tag NBY24_RS24465 Protein ID WP_000813630.1
Coordinates 114060..114278 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY24_RS24445 (109709) 109709..110914 - 1206 WP_001442122.1 AAA family ATPase -
NBY24_RS24450 (111535) 111535..112266 + 732 WP_000504262.1 replication initiation protein -
NBY24_RS24455 (112946) 112946..113752 - 807 WP_000016968.1 site-specific integrase -
NBY24_RS24460 (113753) 113753..114058 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
NBY24_RS24465 (114060) 114060..114278 - 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NBY24_RS24470 (114868) 114868..115356 + 489 WP_011254646.1 hypothetical protein -
NBY24_RS24475 (115390) 115390..116523 - 1134 WP_000545987.1 DUF3800 domain-containing protein -
NBY24_RS24480 (116690) 116690..117463 - 774 WP_000905949.1 hypothetical protein -
NBY24_RS24485 (117476) 117476..117976 - 501 WP_000528932.1 HEPN family nuclease -
NBY24_RS24490 (118241) 118241..118471 + 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin -
NBY24_RS24495 (118468) 118468..118884 + 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD vat / iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN 1..192025 192025


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T246930 WP_001159871.1 NZ_CP098193:c114058-113753 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8354.27 Da        Isoelectric Point: 4.5203

>AT246930 WP_000813630.1 NZ_CP098193:c114278-114060 [Escherichia coli]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTLQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CEF5

References