Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 56865..57400 Replicon plasmid pZ0117ECO0116-1
Accession NZ_CP098193
Organism Escherichia coli strain Z0117EC0116

Toxin (Protein)


Gene name relE Uniprot ID V0VJJ7
Locus tag NBY24_RS24120 Protein ID WP_000222760.1
Coordinates 56865..57152 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0VIP2
Locus tag NBY24_RS24125 Protein ID WP_001132900.1
Coordinates 57149..57400 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY24_RS24090 (52448) 52448..53669 - 1222 Protein_62 ISL3 family transposase -
NBY24_RS24095 (53769) 53769..54133 + 365 Protein_63 IS1 family transposase -
NBY24_RS24100 (54188) 54188..54970 - 783 WP_250780781.1 IS21-like element IS100kyp family helper ATPase IstB -
NBY24_RS24105 (54967) 54967..55989 - 1023 WP_250780782.1 IS21-like element IS100 family transposase -
NBY24_RS24110 (56078) 56078..56425 + 348 Protein_66 IS1-like element IS1A family transposase -
NBY24_RS24115 (56441) 56441..56761 - 321 Protein_67 serine acetyltransferase -
NBY24_RS24120 (56865) 56865..57152 - 288 WP_000222760.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NBY24_RS24125 (57149) 57149..57400 - 252 WP_001132900.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NBY24_RS24130 (58363) 58363..59220 - 858 WP_000774297.1 incFII family plasmid replication initiator RepA -
NBY24_RS24135 (59213) 59213..59695 - 483 WP_001273588.1 hypothetical protein -
NBY24_RS24140 (59688) 59688..59735 - 48 WP_229471593.1 hypothetical protein -
NBY24_RS24145 (59726) 59726..59977 + 252 WP_223195197.1 replication protein RepA -
NBY24_RS24150 (59994) 59994..60251 - 258 WP_000083845.1 replication regulatory protein RepA -
NBY24_RS24155 (60535) 60535..60684 - 150 WP_001312851.1 Hok/Gef family protein -
- (60728) 60728..60789 + 62 NuclAT_1 - -
- (60728) 60728..60789 + 62 NuclAT_1 - -
- (60728) 60728..60789 + 62 NuclAT_1 - -
- (60728) 60728..60789 + 62 NuclAT_1 - -
NBY24_RS24160 (61045) 61045..61119 - 75 Protein_76 endonuclease -
NBY24_RS24165 (61365) 61365..61577 - 213 WP_001299730.1 ANR family transcriptional regulator -
NBY24_RS24170 (61713) 61713..62273 - 561 WP_000139315.1 fertility inhibition protein FinO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD vat / iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN 1..192025 192025


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11105.15 Da        Isoelectric Point: 10.5832

>T246924 WP_000222760.1 NZ_CP098193:c57152-56865 [Escherichia coli]
MTYTVKFRDDALKEWLKLDKSIQQQFAKKLKKCSENPHIPSAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSNVYNLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9211.41 Da        Isoelectric Point: 4.0780

>AT246924 WP_001132900.1 NZ_CP098193:c57400-57149 [Escherichia coli]
MPNIILSDTSASVSELKKNPMATVSAGDGYPVAILNRNQPAFYCVPAELYERMLDALDDQELVKLVTERSNQPLHDVDLD
SYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0VJJ7

Antitoxin

Source ID Structure
AlphaFold DB V0VIP2

References