Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1501729..1502354 | Replicon | chromosome |
| Accession | NZ_CP098192 | ||
| Organism | Escherichia coli strain Z0117EC0116 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NBY24_RS07375 | Protein ID | WP_000911330.1 |
| Coordinates | 1501956..1502354 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | NBY24_RS07370 | Protein ID | WP_000450524.1 |
| Coordinates | 1501729..1501956 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY24_RS07345 (1497533) | 1497533..1498003 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
| NBY24_RS07350 (1498003) | 1498003..1498575 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| NBY24_RS07355 (1498721) | 1498721..1499599 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| NBY24_RS07360 (1499616) | 1499616..1500650 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
| NBY24_RS07365 (1500863) | 1500863..1501576 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| NBY24_RS07370 (1501729) | 1501729..1501956 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| NBY24_RS07375 (1501956) | 1501956..1502354 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NBY24_RS07380 (1502501) | 1502501..1503364 | + | 864 | WP_001267507.1 | neutral zinc metallopeptidase | - |
| NBY24_RS07385 (1503379) | 1503379..1505394 | + | 2016 | WP_000829323.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| NBY24_RS07390 (1505468) | 1505468..1506166 | + | 699 | WP_000679823.1 | esterase | - |
| NBY24_RS07395 (1506276) | 1506276..1506476 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T246914 WP_000911330.1 NZ_CP098192:1501956-1502354 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|