Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 904685..905483 Replicon chromosome
Accession NZ_CP098192
Organism Escherichia coli strain Z0117EC0116

Toxin (Protein)


Gene name yeeV Uniprot ID U9XMP3
Locus tag NBY24_RS04440 Protein ID WP_000854735.1
Coordinates 904685..905062 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A067H947
Locus tag NBY24_RS04445 Protein ID WP_001285415.1
Coordinates 905109..905483 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY24_RS04410 (900656) 900656..901918 - 1263 WP_001218753.1 integrase arm-type DNA-binding domain-containing protein -
NBY24_RS04415 (902382) 902382..902708 - 327 WP_000779483.1 type II toxin-antitoxin system RelE/ParE family toxin -
NBY24_RS04420 (902705) 902705..902968 - 264 WP_001143297.1 type II toxin-antitoxin system ParD family antitoxin -
NBY24_RS04425 (903040) 903040..903906 - 867 WP_001280433.1 DUF4942 domain-containing protein -
NBY24_RS04430 (903991) 903991..904188 - 198 WP_000839291.1 DUF957 domain-containing protein -
NBY24_RS04435 (904200) 904200..904688 - 489 WP_000761676.1 DUF5983 family protein -
NBY24_RS04440 (904685) 904685..905062 - 378 WP_000854735.1 TA system toxin CbtA family protein Toxin
NBY24_RS04445 (905109) 905109..905483 - 375 WP_001285415.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NBY24_RS04450 (905563) 905563..905784 - 222 WP_000692309.1 DUF987 domain-containing protein -
NBY24_RS04455 (905847) 905847..906323 - 477 WP_001366855.1 RadC family protein -
NBY24_RS04460 (906339) 906339..906818 - 480 WP_000844100.1 antirestriction protein -
NBY24_RS04465 (906900) 906900..907718 - 819 WP_001175148.1 DUF932 domain-containing protein -
NBY24_RS04470 (907808) 907808..908041 - 234 WP_001278287.1 DUF905 family protein -
NBY24_RS04475 (908047) 908047..908724 - 678 WP_001097302.1 hypothetical protein -
NBY24_RS04480 (908872) 908872..909552 - 681 WP_001282919.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element sul2 / tet(B) rfaE / gspC / gspD / gspE / gspF / gspG / gspH / gspI / gspJ / gspK / gspL / gspM / papI / papB / papA / papH / papC / papD / papJ / papK / papE / papF / papG 731050..936763 205713


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14061.07 Da        Isoelectric Point: 8.2904

>T246910 WP_000854735.1 NZ_CP098192:c905062-904685 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13663.32 Da        Isoelectric Point: 5.8640

>AT246910 WP_001285415.1 NZ_CP098192:c905483-905109 [Escherichia coli]
VSDTHPGTTHPDNNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9XMP3

Antitoxin

Source ID Structure
AlphaFold DB A0A067H947

References