Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 843079..843914 Replicon chromosome
Accession NZ_CP098192
Organism Escherichia coli strain Z0117EC0116

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag NBY24_RS04090 Protein ID WP_057109034.1
Coordinates 843079..843456 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7MK11
Locus tag NBY24_RS04095 Protein ID WP_001285610.1
Coordinates 843546..843914 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY24_RS04055 (838160) 838160..838759 + 600 WP_001255040.1 type II secretion system minor pseudopilin GspJ -
NBY24_RS04060 (838762) 838762..839739 + 978 WP_000633220.1 type II secretion system minor pseudopilin GspK -
NBY24_RS04065 (839736) 839736..840914 + 1179 WP_000094970.1 type II secretion system protein GspL -
NBY24_RS04070 (840916) 840916..841452 + 537 WP_000942786.1 GspM family type II secretion system protein YghD -
NBY24_RS04075 (841733) 841733..842575 - 843 WP_039004748.1 DUF4942 domain-containing protein -
NBY24_RS04080 (842660) 842660..842857 - 198 WP_023563519.1 DUF957 domain-containing protein -
NBY24_RS04085 (842933) 842933..843082 - 150 Protein_803 DUF5983 family protein -
NBY24_RS04090 (843079) 843079..843456 - 378 WP_057109034.1 TA system toxin CbtA family protein Toxin
NBY24_RS04095 (843546) 843546..843914 - 369 WP_001285610.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NBY24_RS04100 (843988) 843988..844209 - 222 Protein_806 DUF987 domain-containing protein -
NBY24_RS04105 (844296) 844296..844772 - 477 WP_057109035.1 RadC family protein -
NBY24_RS04110 (844788) 844788..845267 - 480 WP_057109036.1 antirestriction protein -
NBY24_RS04115 (845533) 845533..846351 - 819 WP_001175153.1 DUF932 domain-containing protein -
NBY24_RS04120 (846441) 846441..846674 - 234 WP_001278287.1 DUF905 family protein -
NBY24_RS04125 (846680) 846680..847357 - 678 WP_001097368.1 hypothetical protein -
NBY24_RS04130 (847476) 847476..848360 - 885 WP_000010392.1 50S ribosome-binding GTPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element sul2 / tet(B) rfaE / gspC / gspD / gspE / gspF / gspG / gspH / gspI / gspJ / gspK / gspL / gspM / papI / papB / papA / papH / papC / papD / papJ / papK / papE / papF / papG 731050..936763 205713


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13934.86 Da        Isoelectric Point: 6.8517

>T246909 WP_057109034.1 NZ_CP098192:c843456-843079 [Escherichia coli]
MKTLPDTHVREASCCPSPVTIWQTLLTRLLDQHYGLALNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13606.39 Da        Isoelectric Point: 6.0618

>AT246909 WP_001285610.1 NZ_CP098192:c843914-843546 [Escherichia coli]
VSDTLPGTTLPDDNNDRTWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References