Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4264942..4265776 | Replicon | chromosome |
Accession | NZ_CP098187 | ||
Organism | Escherichia coli strain Z0117EC0117 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A2T3TJB4 |
Locus tag | NBY25_RS20735 | Protein ID | WP_000854811.1 |
Coordinates | 4265399..4265776 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A2T3TJJ3 |
Locus tag | NBY25_RS20730 | Protein ID | WP_001285590.1 |
Coordinates | 4264942..4265310 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY25_RS20700 (4261846) | 4261846..4262301 | + | 456 | WP_000581502.1 | IrmA family protein | - |
NBY25_RS25820 (4262319) | 4262319..4262447 | + | 129 | WP_001305405.1 | hypothetical protein | - |
NBY25_RS20705 (4262402) | 4262402..4262573 | + | 172 | Protein_4042 | DUF905 family protein | - |
NBY25_RS20710 (4262691) | 4262691..4263509 | + | 819 | WP_001234593.1 | DUF932 domain-containing protein | - |
NBY25_RS20715 (4263601) | 4263601..4264086 | + | 486 | WP_000214310.1 | antirestriction protein | - |
NBY25_RS20720 (4264102) | 4264102..4264578 | + | 477 | WP_001536299.1 | RadC family protein | - |
NBY25_RS20725 (4264647) | 4264647..4264868 | + | 222 | WP_000692300.1 | DUF987 domain-containing protein | - |
NBY25_RS20730 (4264942) | 4264942..4265310 | + | 369 | WP_001285590.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
NBY25_RS20735 (4265399) | 4265399..4265776 | + | 378 | WP_000854811.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
NBY25_RS20740 (4265773) | 4265773..4266203 | + | 431 | Protein_4049 | DUF5983 family protein | - |
NBY25_RS20745 (4266220) | 4266220..4266396 | + | 177 | WP_000839288.1 | DUF957 domain-containing protein | - |
NBY25_RS20750 (4266502) | 4266502..4266732 | + | 231 | Protein_4051 | hypothetical protein | - |
NBY25_RS20755 (4266758) | 4266758..4267978 | - | 1221 | WP_000794251.1 | capsular biosynthesis protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14041.14 Da Isoelectric Point: 7.8839
>T246898 WP_000854811.1 NZ_CP098187:4265399-4265776 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNIILGKHPEVKQ
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNIILGKHPEVKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13608.50 Da Isoelectric Point: 6.6242
>AT246898 WP_001285590.1 NZ_CP098187:4264942-4265310 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLYSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLYSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2T3TJB4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2T3TJJ3 |