Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 4174350..4175004 | Replicon | chromosome |
| Accession | NZ_CP098187 | ||
| Organism | Escherichia coli strain Z0117EC0117 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | NBY25_RS20230 | Protein ID | WP_000244781.1 |
| Coordinates | 4174350..4174757 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | NBY25_RS20235 | Protein ID | WP_000354046.1 |
| Coordinates | 4174738..4175004 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY25_RS20210 (4170307) | 4170307..4172040 | - | 1734 | WP_000813190.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| NBY25_RS20215 (4172046) | 4172046..4172756 | - | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NBY25_RS20220 (4172781) | 4172781..4173677 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| NBY25_RS20225 (4173789) | 4173789..4174310 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
| NBY25_RS20230 (4174350) | 4174350..4174757 | - | 408 | WP_000244781.1 | protein YgfX | Toxin |
| NBY25_RS20235 (4174738) | 4174738..4175004 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| NBY25_RS20240 (4175247) | 4175247..4176227 | + | 981 | WP_000886080.1 | tRNA-modifying protein YgfZ | - |
| NBY25_RS20245 (4176304) | 4176304..4176963 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
| NBY25_RS20250 (4177127) | 4177127..4177438 | - | 312 | WP_001182948.1 | N(4)-acetylcytidine aminohydrolase | - |
| NBY25_RS20255 (4177483) | 4177483..4178916 | + | 1434 | WP_001350137.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T246897 WP_000244781.1 NZ_CP098187:c4174757-4174350 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|