Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3204030..3204861 Replicon chromosome
Accession NZ_CP098187
Organism Escherichia coli strain Z0117EC0117

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag NBY25_RS15760 Protein ID WP_000854814.1
Coordinates 3204487..3204861 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A366YXM1
Locus tag NBY25_RS15755 Protein ID WP_001518724.1
Coordinates 3204030..3204398 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY25_RS15725 (3200323) 3200323..3200976 + 654 WP_001535423.1 hypothetical protein -
NBY25_RS15730 (3200992) 3200992..3201402 + 411 WP_000846705.1 hypothetical protein -
NBY25_RS15735 (3201623) 3201623..3202444 + 822 WP_001234710.1 DUF932 domain-containing protein -
NBY25_RS15740 (3202707) 3202707..3203180 + 474 WP_000855075.1 antirestriction protein -
NBY25_RS15745 (3203196) 3203196..3203672 + 477 WP_001186773.1 RadC family protein -
NBY25_RS15750 (3203735) 3203735..3203956 + 222 WP_000692323.1 DUF987 domain-containing protein -
NBY25_RS15755 (3204030) 3204030..3204398 + 369 WP_001518724.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
NBY25_RS15760 (3204487) 3204487..3204861 + 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
NBY25_RS15765 (3204858) 3204858..3205052 + 195 WP_000988601.1 DUF5983 family protein -
NBY25_RS15770 (3205098) 3205098..3205178 + 81 Protein_3076 hypothetical protein -
NBY25_RS15775 (3205467) 3205467..3205547 - 81 WP_023441679.1 hypothetical protein -
NBY25_RS15780 (3205526) 3205526..3205849 + 324 WP_223216378.1 EutP/PduV family microcompartment system protein -
NBY25_RS15785 (3205950) 3205950..3206279 - 330 WP_000450409.1 DUF496 family protein -
NBY25_RS15790 (3206451) 3206451..3207509 - 1059 WP_001200894.1 FUSC family protein -
NBY25_RS15795 (3207707) 3207707..3208180 - 474 WP_001105376.1 DNA gyrase inhibitor SbmC -
NBY25_RS15800 (3208299) 3208299..3209465 - 1167 WP_001297905.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T246894 WP_000854814.1 NZ_CP098187:3204487-3204861 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13441.24 Da        Isoelectric Point: 4.7594

>AT246894 WP_001518724.1 NZ_CP098187:3204030-3204398 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLSSDADAYPLDQAFPLLMKQLELMLTSG
ELNPRNQHTVTLYAKGLACEADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A366YXM1

References