Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2075228..2076029 Replicon chromosome
Accession NZ_CP098187
Organism Escherichia coli strain Z0117EC0117

Toxin (Protein)


Gene name yeeV Uniprot ID A0A0H2V687
Locus tag NBY25_RS10015 Protein ID WP_000854739.1
Coordinates 2075649..2076029 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A0P7R0L9
Locus tag NBY25_RS10010 Protein ID WP_001285482.1
Coordinates 2075228..2075602 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY25_RS09970 (2071264) 2071264..2071719 + 456 WP_000581502.1 IrmA family protein -
NBY25_RS25775 (2071737) 2071737..2071865 + 129 WP_001305405.1 hypothetical protein -
NBY25_RS09975 (2071820) 2071820..2071991 + 172 Protein_1935 DUF905 family protein -
NBY25_RS09980 (2072109) 2072109..2072927 + 819 WP_250782030.1 DUF932 domain-containing protein -
NBY25_RS09985 (2072927) 2072927..2073172 + 246 WP_001164966.1 hypothetical protein -
NBY25_RS09990 (2073266) 2073266..2073739 + 474 WP_001313575.1 antirestriction protein -
NBY25_RS09995 (2073755) 2073755..2074231 + 477 WP_001313574.1 RadC family protein -
NBY25_RS10000 (2074294) 2074294..2074515 + 222 WP_000692315.1 DUF987 domain-containing protein -
NBY25_RS10005 (2074534) 2074534..2075178 + 645 WP_000086759.1 hypothetical protein -
NBY25_RS10010 (2075228) 2075228..2075602 + 375 WP_001285482.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NBY25_RS10015 (2075649) 2075649..2076029 + 381 WP_000854739.1 TA system toxin CbtA family protein Toxin
NBY25_RS10020 (2076026) 2076026..2076514 + 489 WP_001518535.1 DUF5983 family protein -
NBY25_RS10025 (2076534) 2076534..2076731 + 198 WP_000772027.1 DUF957 domain-containing protein -
NBY25_RS10030 (2076816) 2076816..2077659 + 844 Protein_1946 DUF4942 domain-containing protein -
NBY25_RS10040 (2078129) 2078129..2079067 + 939 WP_000351277.1 glyoxylate/hydroxypyruvate reductase GhrA -
NBY25_RS10045 (2079122) 2079122..2079859 + 738 WP_000283664.1 zinc-binding phosphatase -
NBY25_RS10050 (2079883) 2079883..2080437 + 555 WP_001001921.1 molecular chaperone YcdY -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 14214.14 Da        Isoelectric Point: 6.4773

>T246888 WP_000854739.1 NZ_CP098187:2075649-2076029 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGVPSQLINSIDILRARRATGLMTRDNYRTVNDITLGRHPEEAKQ

Download         Length: 381 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 13791.44 Da        Isoelectric Point: 4.7511

>AT246888 WP_001285482.1 NZ_CP098187:2075228-2075602 [Escherichia coli]
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H2V687

Antitoxin

Source ID Structure
AlphaFold DB A0A0P7R0L9

References