Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 946146..946696 Replicon chromosome
Accession NZ_CP098187
Organism Escherichia coli strain Z0117EC0117

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag NBY25_RS04545 Protein ID WP_001160966.1
Coordinates 946382..946696 (+) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag NBY25_RS04540 Protein ID WP_000125566.1
Coordinates 946146..946379 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY25_RS04515 (941219) 941219..941506 + 288 WP_000203741.1 ferredoxin-like protein FixX -
NBY25_RS04520 (941565) 941565..942896 + 1332 WP_001183207.1 MFS transporter -
NBY25_RS04525 (943004) 943004..943534 + 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
NBY25_RS04530 (943527) 943527..945389 + 1863 WP_000377124.1 glutathione-regulated potassium-efflux system protein KefC -
NBY25_RS04535 (945581) 945581..946060 + 480 WP_000624375.1 type 3 dihydrofolate reductase -
NBY25_RS04540 (946146) 946146..946379 + 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
NBY25_RS04545 (946382) 946382..946696 + 315 WP_001160966.1 CcdB family protein Toxin
NBY25_RS04550 (946693) 946693..947541 - 849 WP_000257182.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
NBY25_RS04555 (947548) 947548..947925 - 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
NBY25_RS04560 (947928) 947928..948749 - 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
NBY25_RS04565 (948746) 948746..949735 - 990 WP_000241229.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
NBY25_RS04570 (949735) 949735..951021 - 1287 WP_000800457.1 peptidylprolyl isomerase SurA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T246886 WP_001160966.1 NZ_CP098187:946382-946696 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT246886 WP_000125566.1 NZ_CP098187:946146-946379 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References