Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 57699..58234 Replicon plasmid pZ0117ECO0133-2
Accession NZ_CP098185
Organism Escherichia coli strain Z0117EC0133

Toxin (Protein)


Gene name relE Uniprot ID A0A0K4CX11
Locus tag NBY27_RS24710 Protein ID WP_000222771.1
Coordinates 57947..58234 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID T1PXV2
Locus tag NBY27_RS24705 Protein ID WP_001139206.1
Coordinates 57699..57950 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY27_RS24665 (53059) 53059..53247 + 189 WP_001345829.1 hypothetical protein -
NBY27_RS24670 (53445) 53445..53531 + 87 Protein_68 endonuclease -
NBY27_RS24675 (53712) 53712..54023 - 312 WP_000802277.1 hypothetical protein -
- (54319) 54319..54380 - 62 NuclAT_0 - -
- (54319) 54319..54380 - 62 NuclAT_0 - -
- (54319) 54319..54380 - 62 NuclAT_0 - -
- (54319) 54319..54380 - 62 NuclAT_0 - -
NBY27_RS24680 (54424) 54424..54573 + 150 WP_001312851.1 Hok/Gef family protein -
NBY27_RS24685 (54857) 54857..55114 + 258 WP_000083834.1 replication regulatory protein RepA -
NBY27_RS24690 (55348) 55348..55422 + 75 WP_001442103.1 RepA leader peptide Tap -
NBY27_RS24695 (55415) 55415..55897 + 483 WP_074400318.1 hypothetical protein -
NBY27_RS24700 (55890) 55890..56747 + 858 WP_019842754.1 incFII family plasmid replication initiator RepA -
NBY27_RS24705 (57699) 57699..57950 + 252 WP_001139206.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NBY27_RS24710 (57947) 57947..58234 + 288 WP_000222771.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NBY27_RS24715 (58602) 58602..58715 - 114 Protein_77 alkaline phosphatase -
NBY27_RS24720 (58714) 58714..58919 + 206 Protein_78 hypothetical protein -
NBY27_RS24725 (59092) 59092..62589 - 3498 WP_064484791.1 autotransporter outer membrane beta-barrel domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - pefD 1..68250 68250


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11116.17 Da        Isoelectric Point: 10.5833

>T246883 WP_000222771.1 NZ_CP098185:57947-58234 [Escherichia coli]
MTYTVKFRDDALKEWLRLDKTIQQQFAKKLKKCSENPHIASAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSNVYHLASERMK

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9171.39 Da        Isoelectric Point: 4.0927

>AT246883 WP_001139206.1 NZ_CP098185:57699-57950 [Escherichia coli]
MPSIILSDTSASVSELKKNPMATVSAGEGYPVAILNRNQPAFYCVPAELYERMLDALDDQELVKLVTERSSQPLHDVDLD
SYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0K4CX11

Antitoxin

Source ID Structure
AlphaFold DB T1PXV2

References