Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3807523..3808177 | Replicon | chromosome |
Accession | NZ_CP098183 | ||
Organism | Escherichia coli strain Z0117EC0133 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | F4NJ21 |
Locus tag | NBY27_RS18515 | Protein ID | WP_000244772.1 |
Coordinates | 3807523..3807930 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | NBY27_RS18520 | Protein ID | WP_000354046.1 |
Coordinates | 3807911..3808177 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY27_RS18495 (3803480) | 3803480..3805213 | - | 1734 | WP_064484803.1 | single-stranded-DNA-specific exonuclease RecJ | - |
NBY27_RS18500 (3805219) | 3805219..3805929 | - | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NBY27_RS18505 (3805954) | 3805954..3806850 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
NBY27_RS18510 (3806962) | 3806962..3807483 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
NBY27_RS18515 (3807523) | 3807523..3807930 | - | 408 | WP_000244772.1 | protein YgfX | Toxin |
NBY27_RS18520 (3807911) | 3807911..3808177 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
NBY27_RS18525 (3808420) | 3808420..3809400 | + | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
NBY27_RS18530 (3809477) | 3809477..3810136 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
NBY27_RS18535 (3810300) | 3810300..3810611 | - | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
NBY27_RS18540 (3810656) | 3810656..3812089 | + | 1434 | WP_001363803.1 | 6-phospho-beta-glucosidase BglA | - |
NBY27_RS18545 (3812146) | 3812146..3812889 | - | 744 | WP_021564907.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16048.02 Da Isoelectric Point: 11.2511
>T246874 WP_000244772.1 NZ_CP098183:c3807930-3807523 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XYB4 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |