Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 3363262..3363887 | Replicon | chromosome |
| Accession | NZ_CP098183 | ||
| Organism | Escherichia coli strain Z0117EC0133 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NBY27_RS16385 | Protein ID | WP_000911330.1 |
| Coordinates | 3363262..3363660 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U9XQV3 |
| Locus tag | NBY27_RS16390 | Protein ID | WP_000450524.1 |
| Coordinates | 3363660..3363887 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY27_RS16365 (3359169) | 3359169..3359369 | + | 201 | WP_000383836.1 | YpfN family protein | - |
| NBY27_RS16370 (3359450) | 3359450..3360148 | - | 699 | WP_000679812.1 | esterase | - |
| NBY27_RS16375 (3360222) | 3360222..3362237 | - | 2016 | WP_021565358.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
| NBY27_RS16380 (3362252) | 3362252..3363115 | - | 864 | WP_001267508.1 | neutral zinc metallopeptidase | - |
| NBY27_RS16385 (3363262) | 3363262..3363660 | - | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NBY27_RS16390 (3363660) | 3363660..3363887 | - | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| NBY27_RS16395 (3364041) | 3364041..3364754 | - | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| NBY27_RS16400 (3364967) | 3364967..3366001 | - | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
| NBY27_RS16405 (3366018) | 3366018..3366896 | - | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
| NBY27_RS16410 (3367042) | 3367042..3367614 | + | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
| NBY27_RS16415 (3367614) | 3367614..3368084 | + | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T246872 WP_000911330.1 NZ_CP098183:c3363660-3363262 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|