Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2250009..2250647 | Replicon | chromosome |
| Accession | NZ_CP098183 | ||
| Organism | Escherichia coli strain Z0117EC0133 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | NBY27_RS10965 | Protein ID | WP_000813794.1 |
| Coordinates | 2250009..2250185 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NBY27_RS10970 | Protein ID | WP_001270286.1 |
| Coordinates | 2250231..2250647 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY27_RS10945 (2245628) | 2245628..2246842 | - | 1215 | WP_074400312.1 | BenE family transporter YdcO | - |
| NBY27_RS10950 (2246895) | 2246895..2247431 | + | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| NBY27_RS10955 (2247504) | 2247504..2249465 | + | 1962 | WP_001442195.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| NBY27_RS10960 (2249557) | 2249557..2249787 | - | 231 | WP_000494244.1 | YncJ family protein | - |
| NBY27_RS10965 (2250009) | 2250009..2250185 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| NBY27_RS10970 (2250231) | 2250231..2250647 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| NBY27_RS10975 (2250726) | 2250726..2252135 | + | 1410 | WP_000760591.1 | PLP-dependent aminotransferase family protein | - |
| NBY27_RS10980 (2252377) | 2252377..2253522 | + | 1146 | WP_250790918.1 | ABC transporter substrate-binding protein | - |
| NBY27_RS10985 (2253540) | 2253540..2254552 | + | 1013 | Protein_2132 | ABC transporter ATP-binding protein | - |
| NBY27_RS10990 (2254553) | 2254553..2255494 | + | 942 | WP_001251319.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2244440..2245588 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T246865 WP_000813794.1 NZ_CP098183:2250009-2250185 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT246865 WP_001270286.1 NZ_CP098183:2250231-2250647 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|