Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1158455..1159073 | Replicon | chromosome |
| Accession | NZ_CP098183 | ||
| Organism | Escherichia coli strain Z0117EC0133 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | NBY27_RS05400 | Protein ID | WP_001291435.1 |
| Coordinates | 1158455..1158673 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | NBY27_RS05405 | Protein ID | WP_000344800.1 |
| Coordinates | 1158699..1159073 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY27_RS05365 (1153744) | 1153744..1154316 | + | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
| NBY27_RS05370 (1154347) | 1154347..1154658 | - | 312 | WP_000409911.1 | MGMT family protein | - |
| NBY27_RS05380 (1155037) | 1155037..1155390 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| NBY27_RS05385 (1155432) | 1155432..1156982 | - | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| NBY27_RS05390 (1157146) | 1157146..1157616 | - | 471 | WP_000136192.1 | YlaC family protein | - |
| NBY27_RS05395 (1157732) | 1157732..1158283 | - | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| NBY27_RS05400 (1158455) | 1158455..1158673 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| NBY27_RS05405 (1158699) | 1158699..1159073 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| NBY27_RS05410 (1159619) | 1159619..1162768 | - | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
| NBY27_RS05415 (1162791) | 1162791..1163984 | - | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T246860 WP_001291435.1 NZ_CP098183:c1158673-1158455 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT246860 WP_000344800.1 NZ_CP098183:c1159073-1158699 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |