Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 1124157..1124994 | Replicon | chromosome |
Accession | NZ_CP098183 | ||
Organism | Escherichia coli strain Z0117EC0133 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | NBY27_RS05230 | Protein ID | WP_000227784.1 |
Coordinates | 1124157..1124699 (-) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | NBY27_RS05235 | Protein ID | WP_001297137.1 |
Coordinates | 1124683..1124994 (-) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY27_RS05210 (1119696) | 1119696..1120607 | - | 912 | WP_000705874.1 | 2-dehydropantoate 2-reductase | - |
NBY27_RS05215 (1120775) | 1120775..1121266 | + | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
NBY27_RS05220 (1121394) | 1121394..1122758 | - | 1365 | WP_001000974.1 | MFS transporter | - |
NBY27_RS05225 (1123166) | 1123166..1124101 | + | 936 | Protein_1005 | tetratricopeptide repeat protein | - |
NBY27_RS05230 (1124157) | 1124157..1124699 | - | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
NBY27_RS05235 (1124683) | 1124683..1124994 | - | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
NBY27_RS05240 (1125179) | 1125179..1126069 | - | 891 | WP_000971336.1 | heme o synthase | - |
NBY27_RS05245 (1126081) | 1126081..1126410 | - | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
NBY27_RS05250 (1126410) | 1126410..1127024 | - | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
NBY27_RS05255 (1127014) | 1127014..1129005 | - | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
NBY27_RS05260 (1129027) | 1129027..1129974 | - | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T246859 WP_000227784.1 NZ_CP098183:c1124699-1124157 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|