Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 50134..50627 Replicon plasmid pZ0117EC0148-3
Accession NZ_CP098181
Organism Escherichia coli strain Z0117EC0148

Toxin (Protein)


Gene name TsxA Uniprot ID U9Y9W8
Locus tag NBY28_RS25020 Protein ID WP_001230709.1
Coordinates 50134..50388 (+) Length 85 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID U9Y4R8
Locus tag NBY28_RS25025 Protein ID WP_000151456.1
Coordinates 50385..50627 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY28_RS24980 (NBY28_24980) 45650..45802 + 153 Protein_50 DUF5431 family protein -
NBY28_RS24985 (NBY28_24985) 45747..45869 + 123 WP_223202818.1 Hok/Gef family protein -
NBY28_RS24990 (NBY28_24990) 46019..46615 + 597 WP_000125164.1 ProQ/FINO family protein -
NBY28_RS24995 (NBY28_24995) 46633..46917 - 285 WP_001162371.1 hypothetical protein -
NBY28_RS25000 (NBY28_25000) 46991..47656 - 666 WP_000532149.1 division plane positioning ATPase MipZ -
NBY28_RS25005 (NBY28_25005) 48243..48572 + 330 WP_000855119.1 hypothetical protein -
NBY28_RS25010 (NBY28_25010) 48976..49491 + 516 WP_001025393.1 J domain-containing protein -
NBY28_RS25015 (NBY28_25015) 49595..50137 + 543 WP_001083904.1 hypothetical protein -
NBY28_RS25020 (NBY28_25020) 50134..50388 + 255 WP_001230709.1 hypothetical protein Toxin
NBY28_RS25025 (NBY28_25025) 50385..50627 + 243 WP_000151456.1 hypothetical protein Antitoxin
NBY28_RS25030 (NBY28_25030) 51198..51479 + 282 WP_021563355.1 hypothetical protein -
NBY28_RS25035 (NBY28_25035) 51531..51905 + 375 WP_021563356.1 hypothetical protein -
NBY28_RS25040 (NBY28_25040) 51920..52213 + 294 WP_001401669.1 hypothetical protein -
NBY28_RS25045 (NBY28_25045) 52623..53066 - 444 WP_000192626.1 hypothetical protein -
NBY28_RS25050 (NBY28_25050) 53363..53545 + 183 WP_000833470.1 type II toxin-antitoxin system HicA family toxin -
NBY28_RS25055 (NBY28_25055) 53570..54007 + 438 WP_000466318.1 type II toxin-antitoxin system HicB family antitoxin -
NBY28_RS25060 (NBY28_25060) 54138..54458 - 321 WP_001310435.1 hypothetical protein -
NBY28_RS25065 (NBY28_25065) 54792..54970 - 179 Protein_67 hypothetical protein -
NBY28_RS25070 (NBY28_25070) 55007..55270 - 264 WP_000224227.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - - 1..60138 60138


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9942.47 Da        Isoelectric Point: 10.1206

>T246853 WP_001230709.1 NZ_CP098181:50134-50388 [Escherichia coli]
MRKNKGRLTYYLEVIDKKYHFVKKISSYSKEFTDGKTKRTKRTLSELVFNESEVEAIDFTKNGLRPVDKNILLTMVKEYK
ESDA

Download         Length: 255 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9136.45 Da        Isoelectric Point: 7.2775

>AT246853 WP_000151456.1 NZ_CP098181:50385-50627 [Escherichia coli]
MTIENTPENIKKLRKKIGLTQTECGEIFGVGLSTWQKKEAKTHNQLNLSKGEFEYLLLLAGEHPEYVLHKKAESRSPEEP

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3G9H8F0

Antitoxin

Source ID Structure
AlphaFold DB A0A3G9GNF5

References