Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1290..1915 | Replicon | plasmid pZ0117EC0148-1 |
Accession | NZ_CP098179 | ||
Organism | Escherichia coli strain Z0117EC0148 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NBY28_RS23465 | Protein ID | WP_000911313.1 |
Coordinates | 1517..1915 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | V0VCB2 |
Locus tag | NBY28_RS23460 | Protein ID | WP_000450520.1 |
Coordinates | 1290..1517 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY28_RS23460 (1290) | 1290..1517 | + | 228 | WP_000450520.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
NBY28_RS23465 (1517) | 1517..1915 | + | 399 | WP_000911313.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NBY28_RS23470 (1924) | 1924..4077 | - | 2154 | WP_000009324.1 | type IV conjugative transfer system coupling protein TraD | - |
NBY28_RS23475 (4330) | 4330..5061 | - | 732 | WP_023565183.1 | conjugal transfer complement resistance protein TraT | - |
NBY28_RS23480 (5093) | 5093..5590 | - | 498 | WP_000605857.1 | entry exclusion protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sitABCD / blaTEM-1B / tet(A) | iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN | 1..121118 | 121118 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14901.15 Da Isoelectric Point: 7.8605
>T246840 WP_000911313.1 NZ_CP098179:1517-1915 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|