Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3918319..3918973 | Replicon | chromosome |
| Accession | NZ_CP098178 | ||
| Organism | Escherichia coli strain Z0117EC0148 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | F4NJ21 |
| Locus tag | NBY28_RS19100 | Protein ID | WP_000244772.1 |
| Coordinates | 3918319..3918726 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | NBY28_RS19105 | Protein ID | WP_000354046.1 |
| Coordinates | 3918707..3918973 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY28_RS19080 (3914276) | 3914276..3916009 | - | 1734 | WP_000813210.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| NBY28_RS19085 (3916015) | 3916015..3916725 | - | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NBY28_RS19090 (3916750) | 3916750..3917646 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| NBY28_RS19095 (3917758) | 3917758..3918279 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
| NBY28_RS19100 (3918319) | 3918319..3918726 | - | 408 | WP_000244772.1 | protein YgfX | Toxin |
| NBY28_RS19105 (3918707) | 3918707..3918973 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| NBY28_RS19110 (3919216) | 3919216..3920196 | + | 981 | WP_001472148.1 | tRNA-modifying protein YgfZ | - |
| NBY28_RS19115 (3920273) | 3920273..3920932 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
| NBY28_RS19120 (3921096) | 3921096..3921407 | - | 312 | WP_001182944.1 | N(4)-acetylcytidine aminohydrolase | - |
| NBY28_RS19125 (3921452) | 3921452..3922885 | + | 1434 | WP_001307385.1 | 6-phospho-beta-glucosidase BglA | - |
| NBY28_RS19130 (3922942) | 3922942..3923685 | - | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16048.02 Da Isoelectric Point: 11.2511
>T246837 WP_000244772.1 NZ_CP098178:c3918726-3918319 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XYB4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |