Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 3485869..3486494 | Replicon | chromosome |
Accession | NZ_CP098178 | ||
Organism | Escherichia coli strain Z0117EC0148 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NBY28_RS17055 | Protein ID | WP_000911330.1 |
Coordinates | 3485869..3486267 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | NBY28_RS17060 | Protein ID | WP_000450524.1 |
Coordinates | 3486267..3486494 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY28_RS17035 (3481747) | 3481747..3481947 | + | 201 | WP_000383836.1 | YpfN family protein | - |
NBY28_RS17040 (3482057) | 3482057..3482755 | - | 699 | WP_000679823.1 | esterase | - |
NBY28_RS17045 (3482829) | 3482829..3484844 | - | 2016 | WP_000829294.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
NBY28_RS17050 (3484859) | 3484859..3485722 | - | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
NBY28_RS17055 (3485869) | 3485869..3486267 | - | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NBY28_RS17060 (3486267) | 3486267..3486494 | - | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
NBY28_RS17065 (3486648) | 3486648..3487361 | - | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
NBY28_RS17070 (3487574) | 3487574..3488608 | - | 1035 | WP_001330579.1 | outer membrane protein assembly factor BamC | - |
NBY28_RS17075 (3488625) | 3488625..3489503 | - | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
NBY28_RS17080 (3489649) | 3489649..3490221 | + | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
NBY28_RS17085 (3490221) | 3490221..3490691 | + | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T246835 WP_000911330.1 NZ_CP098178:c3486267-3485869 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|