Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
| Location | 1218954..1219791 | Replicon | chromosome |
| Accession | NZ_CP098178 | ||
| Organism | Escherichia coli strain Z0117EC0148 | ||
Toxin (Protein)
| Gene name | itaT | Uniprot ID | Q3Z4X7 |
| Locus tag | NBY28_RS05880 | Protein ID | WP_000227784.1 |
| Coordinates | 1218954..1219496 (-) | Length | 181 a.a. |
Antitoxin (Protein)
| Gene name | itaR | Uniprot ID | I2UQS9 |
| Locus tag | NBY28_RS05885 | Protein ID | WP_001297137.1 |
| Coordinates | 1219480..1219791 (-) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY28_RS05860 (1214493) | 1214493..1215404 | - | 912 | WP_000705874.1 | 2-dehydropantoate 2-reductase | - |
| NBY28_RS05865 (1215572) | 1215572..1216063 | + | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
| NBY28_RS05870 (1216191) | 1216191..1217555 | - | 1365 | WP_001000960.1 | MFS transporter | - |
| NBY28_RS05875 (1217963) | 1217963..1218898 | + | 936 | WP_001368479.1 | tetratricopeptide repeat protein | - |
| NBY28_RS05880 (1218954) | 1218954..1219496 | - | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
| NBY28_RS05885 (1219480) | 1219480..1219791 | - | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
| NBY28_RS05890 (1219976) | 1219976..1220866 | - | 891 | WP_000971336.1 | heme o synthase | - |
| NBY28_RS05895 (1220878) | 1220878..1221207 | - | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
| NBY28_RS05900 (1221207) | 1221207..1221821 | - | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
| NBY28_RS05905 (1221811) | 1221811..1223802 | - | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
| NBY28_RS05910 (1223824) | 1223824..1224771 | - | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T246824 WP_000227784.1 NZ_CP098178:c1219496-1218954 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|