Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1236815..1237434 Replicon chromosome
Accession NZ_CP098175
Organism Klebsiella pneumoniae strain Z0117KP0001

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NBY29_RS05895 Protein ID WP_002892050.1
Coordinates 1236815..1237033 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NBY29_RS05900 Protein ID WP_002892066.1
Coordinates 1237060..1237434 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY29_RS05860 (1232862) 1232862..1233125 + 264 WP_002892011.1 type B 50S ribosomal protein L31 -
NBY29_RS05865 (1233125) 1233125..1233265 + 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NBY29_RS05870 (1233262) 1233262..1233960 - 699 WP_002892021.1 GNAT family protein -
NBY29_RS05875 (1234061) 1234061..1235512 + 1452 WP_023302231.1 PLP-dependent aminotransferase family protein -
NBY29_RS05880 (1235487) 1235487..1235957 - 471 WP_002892026.1 YlaC family protein -
NBY29_RS05885 (1235978) 1235978..1236118 + 141 WP_004147370.1 hypothetical protein -
NBY29_RS05890 (1236090) 1236090..1236656 - 567 WP_002892030.1 maltose O-acetyltransferase -
NBY29_RS05895 (1236815) 1236815..1237033 - 219 WP_002892050.1 HHA domain-containing protein Toxin
NBY29_RS05900 (1237060) 1237060..1237434 - 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NBY29_RS05905 (1237920) 1237920..1241066 - 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NBY29_RS05910 (1241089) 1241089..1242282 - 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T246811 WP_002892050.1 NZ_CP098175:c1237033-1236815 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT246811 WP_002892066.1 NZ_CP098175:c1237434-1237060 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References