Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 612987..613797 | Replicon | chromosome |
Accession | NZ_CP098175 | ||
Organism | Klebsiella pneumoniae strain Z0117KP0001 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | A0A060VJ83 |
Locus tag | NBY29_RS02875 | Protein ID | WP_004178461.1 |
Coordinates | 613264..613797 (+) | Length | 178 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | J2E9Q7 |
Locus tag | NBY29_RS02870 | Protein ID | WP_002887278.1 |
Coordinates | 612987..613253 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY29_RS02850 (608859) | 608859..609203 | - | 345 | WP_004214146.1 | cation efflux system protein CusF | - |
NBY29_RS02855 (609221) | 609221..610606 | - | 1386 | WP_023302432.1 | efflux transporter outer membrane subunit | - |
NBY29_RS02860 (610778) | 610778..611461 | + | 684 | WP_023302433.1 | copper response regulator transcription factor CusR | - |
NBY29_RS02865 (611451) | 611451..612884 | + | 1434 | WP_029498528.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
NBY29_RS02870 (612987) | 612987..613253 | + | 267 | WP_002887278.1 | type II toxin-antitoxin system antitoxin KacA | Antitoxin |
NBY29_RS02875 (613264) | 613264..613797 | + | 534 | WP_004178461.1 | type II toxin-antitoxin system toxin KacT | Toxin |
NBY29_RS02880 (613845) | 613845..614966 | - | 1122 | WP_012737335.1 | cupin domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19810.65 Da Isoelectric Point: 5.2614
>T246810 WP_004178461.1 NZ_CP098175:613264-613797 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A060VJ83 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 5ZGN | |
AlphaFold DB | A0A0H3GLZ1 |