Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 522718..523234 | Replicon | chromosome |
| Accession | NZ_CP098175 | ||
| Organism | Klebsiella pneumoniae strain Z0117KP0001 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | J2XDK6 |
| Locus tag | NBY29_RS02460 | Protein ID | WP_002886902.1 |
| Coordinates | 522950..523234 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | NBY29_RS02455 | Protein ID | WP_002886901.1 |
| Coordinates | 522718..522960 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY29_RS02440 (518746) | 518746..519486 | + | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
| NBY29_RS02445 (519553) | 519553..520707 | + | 1155 | WP_085808042.1 | lactonase family protein | - |
| NBY29_RS02450 (520730) | 520730..522640 | + | 1911 | WP_009486549.1 | PRD domain-containing protein | - |
| NBY29_RS02455 (522718) | 522718..522960 | + | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NBY29_RS02460 (522950) | 522950..523234 | + | 285 | WP_002886902.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NBY29_RS02465 (523238) | 523238..523702 | - | 465 | WP_023302390.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| NBY29_RS02470 (524011) | 524011..526149 | - | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| NBY29_RS02475 (526506) | 526506..527249 | - | 744 | WP_021441079.1 | MurR/RpiR family transcriptional regulator | - |
| NBY29_RS02480 (527252) | 527252..527425 | - | 174 | WP_032410138.1 | hypothetical protein | - |
| NBY29_RS02485 (527555) | 527555..527818 | + | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.3787
>T246809 WP_002886902.1 NZ_CP098175:522950-523234 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GMH2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |