Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/ElaA-DUF1778 |
| Location | 160208..160959 | Replicon | plasmid pZ0117KP0003-1 |
| Accession | NZ_CP098170 | ||
| Organism | Klebsiella pneumoniae strain Z0117KP0003 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | H6U1U8 |
| Locus tag | NBY30_RS24810 | Protein ID | WP_014386536.1 |
| Coordinates | 160208..160690 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | A0A071LPN3 |
| Locus tag | NBY30_RS24815 | Protein ID | WP_004902250.1 |
| Coordinates | 160681..160959 (-) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY30_RS24790 (NBY30_24780) | 156607..157254 | - | 648 | WP_014386537.1 | EcsC family protein | - |
| NBY30_RS24795 (NBY30_24785) | 157281..158036 | - | 756 | WP_004902235.1 | DUF2971 domain-containing protein | - |
| NBY30_RS24800 (NBY30_24790) | 158137..158529 | - | 393 | WP_032442757.1 | hypothetical protein | - |
| NBY30_RS24805 (NBY30_24795) | 158634..159173 | - | 540 | WP_004902239.1 | hypothetical protein | - |
| NBY30_RS24810 (NBY30_24800) | 160208..160690 | - | 483 | WP_014386536.1 | GNAT family N-acetyltransferase | Toxin |
| NBY30_RS24815 (NBY30_24805) | 160681..160959 | - | 279 | WP_004902250.1 | DUF1778 domain-containing protein | Antitoxin |
| NBY30_RS24820 (NBY30_24810) | 161078..161290 | - | 213 | WP_004902255.1 | hypothetical protein | - |
| NBY30_RS24825 (NBY30_24815) | 161398..161739 | - | 342 | WP_004902257.1 | hypothetical protein | - |
| NBY30_RS24830 (NBY30_24820) | 162569..163027 | - | 459 | WP_014386535.1 | hypothetical protein | - |
| NBY30_RS24835 (NBY30_24825) | 163680..164135 | - | 456 | WP_250833687.1 | Hg(II)-responsive transcriptional regulator | - |
| NBY30_RS24840 (NBY30_24830) | 164207..164572 | + | 366 | WP_001294656.1 | mercuric ion transporter MerT | - |
| NBY30_RS24845 (NBY30_24835) | 164588..164863 | + | 276 | WP_000732275.1 | mercury resistance system periplasmic binding protein MerP | - |
| NBY30_RS24850 (NBY30_24840) | 164891..165316 | + | 426 | WP_000522996.1 | organomercurial transporter MerC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | tet(B) / aph(3')-Ia | - | 1..253995 | 253995 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17662.45 Da Isoelectric Point: 8.9130
>T246806 WP_014386536.1 NZ_CP098170:c160690-160208 [Klebsiella pneumoniae]
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNTVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2A5MBI1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A071LPN3 |