Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 3447364..3448100 | Replicon | chromosome |
| Accession | NZ_CP098169 | ||
| Organism | Klebsiella pneumoniae strain Z0117KP0003 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A4S4Y1H2 |
| Locus tag | NBY30_RS16695 | Protein ID | WP_032433360.1 |
| Coordinates | 3447618..3448100 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | NBY30_RS16690 | Protein ID | WP_003026799.1 |
| Coordinates | 3447364..3447630 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY30_RS16665 (3443010) | 3443010..3444149 | + | 1140 | WP_032433368.1 | mannitol dehydrogenase | - |
| NBY30_RS16670 (3444178) | 3444178..3444840 | + | 663 | WP_032433366.1 | dihydroxyacetone kinase subunit DhaL | - |
| NBY30_RS16675 (3444821) | 3444821..3445828 | + | 1008 | WP_280954017.1 | dihydroxyacetone kinase subunit DhaK | - |
| NBY30_RS16680 (3445846) | 3445846..3446478 | + | 633 | WP_032433362.1 | 3-hexulose-6-phosphate synthase | - |
| NBY30_RS16685 (3446488) | 3446488..3447051 | + | 564 | WP_032433361.1 | 6-phospho-3-hexuloisomerase | - |
| NBY30_RS16690 (3447364) | 3447364..3447630 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| NBY30_RS16695 (3447618) | 3447618..3448100 | + | 483 | WP_032433360.1 | GNAT family N-acetyltransferase | Toxin |
| NBY30_RS16700 (3448300) | 3448300..3449703 | + | 1404 | WP_001567368.1 | ISNCY-like element ISKpn21 family transposase | - |
| NBY30_RS16705 (3449732) | 3449732..3450364 | - | 633 | WP_250833685.1 | hypothetical protein | - |
| NBY30_RS16710 (3450744) | 3450744..3451343 | - | 600 | WP_032432064.1 | helix-turn-helix transcriptional regulator | - |
| NBY30_RS16715 (3451556) | 3451556..3452500 | - | 945 | WP_077254249.1 | fimbrial protein | - |
| NBY30_RS16720 (3452512) | 3452512..3453090 | - | 579 | WP_032432061.1 | type 1 fimbrial protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3416249..3461326 | 45077 | |
| - | flank | IS/Tn | - | - | 3448300..3449703 | 1403 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17421.02 Da Isoelectric Point: 9.6047
>T246799 WP_032433360.1 NZ_CP098169:3447618-3448100 [Klebsiella pneumoniae]
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4S4Y1H2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |