Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 3429335..3429978 | Replicon | chromosome |
| Accession | NZ_CP098169 | ||
| Organism | Klebsiella pneumoniae strain Z0117KP0003 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | A0A4S8C081 |
| Locus tag | NBY30_RS16590 | Protein ID | WP_032433387.1 |
| Coordinates | 3429562..3429978 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q84A07 |
| Locus tag | NBY30_RS16585 | Protein ID | WP_001261276.1 |
| Coordinates | 3429335..3429565 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY30_RS16570 (3424357) | 3424357..3425444 | + | 1088 | Protein_3216 | transcriptional repressor PifC | - |
| NBY30_RS16575 (3425447) | 3425447..3427687 | + | 2241 | WP_045326788.1 | P-loop NTPase fold protein | - |
| NBY30_RS16580 (3428215) | 3428215..3429030 | - | 816 | WP_032433388.1 | hypothetical protein | - |
| NBY30_RS16585 (3429335) | 3429335..3429565 | + | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NBY30_RS16590 (3429562) | 3429562..3429978 | + | 417 | WP_032433387.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NBY30_RS16595 (3430134) | 3430134..3431114 | + | 981 | WP_032433385.1 | hypothetical protein | - |
| NBY30_RS16600 (3431309) | 3431309..3432880 | - | 1572 | WP_250833665.1 | AAA family ATPase | - |
| NBY30_RS16605 (3433199) | 3433199..3433447 | + | 249 | WP_032433382.1 | hypothetical protein | - |
| NBY30_RS16610 (3433506) | 3433506..3434024 | + | 519 | WP_045326794.1 | hypothetical protein | - |
| NBY30_RS16615 (3434055) | 3434055..3434282 | + | 228 | Protein_3225 | DNA-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3416249..3461326 | 45077 | |
| - | flank | IS/Tn | - | - | 3434305..3435513 | 1208 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14974.43 Da Isoelectric Point: 7.8921
>T246798 WP_032433387.1 NZ_CP098169:3429562-3429978 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4S8C081 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K023 |