Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 1325477..1325993 | Replicon | chromosome |
Accession | NZ_CP098169 | ||
Organism | Klebsiella pneumoniae strain Z0117KP0003 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A2A2BGN7 |
Locus tag | NBY30_RS06230 | Protein ID | WP_009486548.1 |
Coordinates | 1325477..1325761 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | NBY30_RS06235 | Protein ID | WP_002886901.1 |
Coordinates | 1325751..1325993 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY30_RS06205 (1320894) | 1320894..1321157 | - | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
NBY30_RS06210 (1321287) | 1321287..1321460 | + | 174 | WP_032433782.1 | hypothetical protein | - |
NBY30_RS06215 (1321463) | 1321463..1322206 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
NBY30_RS06220 (1322563) | 1322563..1324701 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NBY30_RS06225 (1325009) | 1325009..1325473 | + | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NBY30_RS06230 (1325477) | 1325477..1325761 | - | 285 | WP_009486548.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NBY30_RS06235 (1325751) | 1325751..1325993 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NBY30_RS06240 (1326071) | 1326071..1327981 | - | 1911 | WP_009486549.1 | PRD domain-containing protein | - |
NBY30_RS06245 (1328004) | 1328004..1329158 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
NBY30_RS06250 (1329225) | 1329225..1329965 | - | 741 | WP_009486551.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.4951
>T246791 WP_009486548.1 NZ_CP098169:c1325761-1325477 [Klebsiella pneumoniae]
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A2BGN7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |