Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4826301..4826817 | Replicon | chromosome |
| Accession | NZ_CP098167 | ||
| Organism | Klebsiella pneumoniae strain Z0117KP0004 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | R4YAY3 |
| Locus tag | NBY32_RS23315 | Protein ID | WP_004178374.1 |
| Coordinates | 4826301..4826585 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A919M0P8 |
| Locus tag | NBY32_RS23320 | Protein ID | WP_032434351.1 |
| Coordinates | 4826575..4826817 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY32_RS23290 (4821784) | 4821784..4822047 | - | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
| NBY32_RS23295 (4822177) | 4822177..4822350 | + | 174 | WP_032414379.1 | hypothetical protein | - |
| NBY32_RS23300 (4822353) | 4822353..4823096 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| NBY32_RS23305 (4823453) | 4823453..4825591 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| NBY32_RS23310 (4825833) | 4825833..4826297 | + | 465 | WP_004222151.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| NBY32_RS23315 (4826301) | 4826301..4826585 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NBY32_RS23320 (4826575) | 4826575..4826817 | - | 243 | WP_032434351.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NBY32_RS23325 (4826895) | 4826895..4828805 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
| NBY32_RS23330 (4828828) | 4828828..4829982 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
| NBY32_RS23335 (4830048) | 4830048..4830788 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T246785 WP_004178374.1 NZ_CP098167:c4826585-4826301 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|