Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 4733573..4734276 | Replicon | chromosome |
Accession | NZ_CP098167 | ||
Organism | Klebsiella pneumoniae strain Z0117KP0004 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | A0A939NMR5 |
Locus tag | NBY32_RS22920 | Protein ID | WP_071994632.1 |
Coordinates | 4733573..4733914 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | A0A939NIK9 |
Locus tag | NBY32_RS22925 | Protein ID | WP_032434296.1 |
Coordinates | 4733935..4734276 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY32_RS22910 (4729888) | 4729888..4730757 | + | 870 | WP_023317468.1 | HNH endonuclease | - |
NBY32_RS22915 (4731348) | 4731348..4733381 | + | 2034 | WP_050598589.1 | hypothetical protein | - |
NBY32_RS22920 (4733573) | 4733573..4733914 | - | 342 | WP_071994632.1 | TA system toxin CbtA family protein | Toxin |
NBY32_RS22925 (4733935) | 4733935..4734276 | - | 342 | WP_032434296.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NBY32_RS22930 (4734287) | 4734287..4734829 | - | 543 | WP_032434298.1 | DNA repair protein RadC | - |
NBY32_RS22935 (4734842) | 4734842..4735282 | - | 441 | WP_032434300.1 | antirestriction protein | - |
NBY32_RS22940 (4735313) | 4735313..4736134 | - | 822 | WP_032434301.1 | DUF932 domain-containing protein | - |
NBY32_RS22945 (4736254) | 4736254..4736727 | - | 474 | WP_032434303.1 | hypothetical protein | - |
NBY32_RS22950 (4736799) | 4736799..4737251 | - | 453 | WP_032410767.1 | hypothetical protein | - |
NBY32_RS22955 (4737287) | 4737287..4738003 | - | 717 | WP_032434305.1 | WYL domain-containing protein | - |
NBY32_RS22960 (4738247) | 4738247..4739121 | - | 875 | Protein_4503 | GTPase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4721870..4767543 | 45673 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12789.77 Da Isoelectric Point: 9.6552
>T246784 WP_071994632.1 NZ_CP098167:c4733914-4733573 [Klebsiella pneumoniae]
MKTLPATTPQAVTLCLSSVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRKGF
NWQEHSPYLRAVDILRARQATGLLRRSRKNAVR
MKTLPATTPQAVTLCLSSVAVWQMLLARLLEQHYGLTLNDTPFSDETVIQEHIDAGISLADAVNFLVEKYGLVRIDRKGF
NWQEHSPYLRAVDILRARQATGLLRRSRKNAVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|