Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 862855..863512 | Replicon | chromosome |
| Accession | NZ_CP098167 | ||
| Organism | Klebsiella pneumoniae strain Z0117KP0004 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | W8UCT0 |
| Locus tag | NBY32_RS04340 | Protein ID | WP_002916310.1 |
| Coordinates | 863102..863512 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | NBY32_RS04335 | Protein ID | WP_002916312.1 |
| Coordinates | 862855..863121 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY32_RS04310 (858063) | 858063..859496 | - | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
| NBY32_RS04315 (859615) | 859615..860343 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
| NBY32_RS04320 (860393) | 860393..860704 | + | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
| NBY32_RS04325 (860868) | 860868..861527 | + | 660 | WP_004174454.1 | hemolysin III family protein | - |
| NBY32_RS04330 (861626) | 861626..862609 | - | 984 | WP_023286864.1 | tRNA-modifying protein YgfZ | - |
| NBY32_RS04335 (862855) | 862855..863121 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| NBY32_RS04340 (863102) | 863102..863512 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
| NBY32_RS04345 (863519) | 863519..864040 | - | 522 | WP_002916308.1 | flavodoxin FldB | - |
| NBY32_RS04350 (864141) | 864141..865037 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
| NBY32_RS04355 (865060) | 865060..865773 | + | 714 | WP_004174456.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NBY32_RS04360 (865779) | 865779..867512 | + | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T246775 WP_002916310.1 NZ_CP098167:863102-863512 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GSW7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GY41 |