Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 54608..55344 Replicon plasmid pZ0117KP0005-1
Accession NZ_CP098166
Organism Klebsiella pneumoniae strain Z0117KP0005

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag NBY34_RS26105 Protein ID WP_003026803.1
Coordinates 54862..55344 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag NBY34_RS26100 Protein ID WP_003026799.1
Coordinates 54608..54874 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY34_RS26055 (NBY34_26060) 50670..51032 - 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -
NBY34_RS26060 (NBY34_26065) 51082..51432 - 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
NBY34_RS26065 (NBY34_26070) 51790..52059 + 270 WP_004152102.1 hypothetical protein -
NBY34_RS26070 (NBY34_26075) 52047..52622 + 576 WP_004152103.1 hypothetical protein -
NBY34_RS26075 (NBY34_26080) 52653..53147 + 495 WP_004152104.1 DNA-binding protein -
NBY34_RS26080 (NBY34_26085) 53191..53559 + 369 WP_004152105.1 hypothetical protein -
NBY34_RS26085 (NBY34_26090) 53593..53796 + 204 WP_004152106.1 HHA domain-containing protein -
NBY34_RS26090 (NBY34_26095) 53845..54102 + 258 WP_004152107.1 hypothetical protein -
NBY34_RS26095 (NBY34_26100) 54178..54432 + 255 WP_004152108.1 hypothetical protein -
NBY34_RS26100 (NBY34_26105) 54608..54874 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
NBY34_RS26105 (NBY34_26110) 54862..55344 + 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
NBY34_RS26110 (NBY34_26115) 55552..56898 + 1347 WP_077253535.1 ISNCY family transposase -
NBY34_RS26115 (NBY34_26120) 56947..57342 + 396 WP_004143398.1 helix-turn-helix domain-containing protein -
NBY34_RS26120 (NBY34_26125) 57490..58655 - 1166 Protein_60 IS3 family transposase -
NBY34_RS26125 (NBY34_26130) 58832..59794 - 963 WP_004152113.1 zinc metalloprotease HtpX -
NBY34_RS26130 (NBY34_26135) 59781..60269 - 489 WP_004152114.1 phosphate-starvation-inducible PsiE family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / blaCTX-M-15 / dfrA14 / aac(3)-IIa / aac(6')-Ib-cr / blaOXA-1 / tet(A) / qnrB1 - 1..154762 154762


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T246772 WP_003026803.1 NZ_CP098166:54862-55344 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT246772 WP_003026799.1 NZ_CP098166:54608-54874 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References