Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 54608..55344 | Replicon | plasmid pZ0117KP0005-1 |
| Accession | NZ_CP098166 | ||
| Organism | Klebsiella pneumoniae strain Z0117KP0005 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | L7SZ15 |
| Locus tag | NBY34_RS26105 | Protein ID | WP_003026803.1 |
| Coordinates | 54862..55344 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | NBY34_RS26100 | Protein ID | WP_003026799.1 |
| Coordinates | 54608..54874 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NBY34_RS26055 (NBY34_26060) | 50670..51032 | - | 363 | WP_004152100.1 | arsenite efflux transporter metallochaperone ArsD | - |
| NBY34_RS26060 (NBY34_26065) | 51082..51432 | - | 351 | WP_004152101.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
| NBY34_RS26065 (NBY34_26070) | 51790..52059 | + | 270 | WP_004152102.1 | hypothetical protein | - |
| NBY34_RS26070 (NBY34_26075) | 52047..52622 | + | 576 | WP_004152103.1 | hypothetical protein | - |
| NBY34_RS26075 (NBY34_26080) | 52653..53147 | + | 495 | WP_004152104.1 | DNA-binding protein | - |
| NBY34_RS26080 (NBY34_26085) | 53191..53559 | + | 369 | WP_004152105.1 | hypothetical protein | - |
| NBY34_RS26085 (NBY34_26090) | 53593..53796 | + | 204 | WP_004152106.1 | HHA domain-containing protein | - |
| NBY34_RS26090 (NBY34_26095) | 53845..54102 | + | 258 | WP_004152107.1 | hypothetical protein | - |
| NBY34_RS26095 (NBY34_26100) | 54178..54432 | + | 255 | WP_004152108.1 | hypothetical protein | - |
| NBY34_RS26100 (NBY34_26105) | 54608..54874 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| NBY34_RS26105 (NBY34_26110) | 54862..55344 | + | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
| NBY34_RS26110 (NBY34_26115) | 55552..56898 | + | 1347 | WP_077253535.1 | ISNCY family transposase | - |
| NBY34_RS26115 (NBY34_26120) | 56947..57342 | + | 396 | WP_004143398.1 | helix-turn-helix domain-containing protein | - |
| NBY34_RS26120 (NBY34_26125) | 57490..58655 | - | 1166 | Protein_60 | IS3 family transposase | - |
| NBY34_RS26125 (NBY34_26130) | 58832..59794 | - | 963 | WP_004152113.1 | zinc metalloprotease HtpX | - |
| NBY34_RS26130 (NBY34_26135) | 59781..60269 | - | 489 | WP_004152114.1 | phosphate-starvation-inducible PsiE family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / blaCTX-M-15 / dfrA14 / aac(3)-IIa / aac(6')-Ib-cr / blaOXA-1 / tet(A) / qnrB1 | - | 1..154762 | 154762 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T246772 WP_003026803.1 NZ_CP098166:54862-55344 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2GNW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |