Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 4492577..4493234 | Replicon | chromosome |
Accession | NZ_CP098165 | ||
Organism | Klebsiella pneumoniae strain Z0117KP0005 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | NBY34_RS21485 | Protein ID | WP_002916310.1 |
Coordinates | 4492577..4492987 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | NBY34_RS21490 | Protein ID | WP_002916312.1 |
Coordinates | 4492968..4493234 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY34_RS21465 (4488577) | 4488577..4490310 | - | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
NBY34_RS21470 (4490316) | 4490316..4491029 | - | 714 | WP_004174456.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NBY34_RS21475 (4491052) | 4491052..4491948 | - | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
NBY34_RS21480 (4492049) | 4492049..4492570 | + | 522 | WP_002916308.1 | flavodoxin FldB | - |
NBY34_RS21485 (4492577) | 4492577..4492987 | - | 411 | WP_002916310.1 | protein YgfX | Toxin |
NBY34_RS21490 (4492968) | 4492968..4493234 | - | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
NBY34_RS21495 (4493480) | 4493480..4494463 | + | 984 | WP_023286864.1 | tRNA-modifying protein YgfZ | - |
NBY34_RS21500 (4494562) | 4494562..4495221 | - | 660 | WP_004174454.1 | hemolysin III family protein | - |
NBY34_RS21505 (4495385) | 4495385..4495696 | - | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
NBY34_RS21510 (4495746) | 4495746..4496474 | + | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
NBY34_RS21515 (4496593) | 4496593..4498026 | + | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T246769 WP_002916310.1 NZ_CP098165:c4492987-4492577 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |