Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1294223..1294842 Replicon chromosome
Accession NZ_CP098165
Organism Klebsiella pneumoniae strain Z0117KP0005

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NBY34_RS06120 Protein ID WP_002892050.1
Coordinates 1294223..1294441 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NBY34_RS06125 Protein ID WP_002892066.1
Coordinates 1294468..1294842 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY34_RS06085 (1290270) 1290270..1290533 + 264 WP_002892011.1 type B 50S ribosomal protein L31 -
NBY34_RS06090 (1290533) 1290533..1290673 + 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NBY34_RS06095 (1290670) 1290670..1291368 - 699 WP_032435564.1 GNAT family protein -
NBY34_RS06100 (1291469) 1291469..1292920 + 1452 WP_032435563.1 PLP-dependent aminotransferase family protein -
NBY34_RS06105 (1292895) 1292895..1293365 - 471 WP_002892026.1 YlaC family protein -
NBY34_RS06110 (1293386) 1293386..1293526 + 141 WP_004147370.1 hypothetical protein -
NBY34_RS06115 (1293498) 1293498..1294064 - 567 WP_002892030.1 maltose O-acetyltransferase -
NBY34_RS06120 (1294223) 1294223..1294441 - 219 WP_002892050.1 HHA domain-containing protein Toxin
NBY34_RS06125 (1294468) 1294468..1294842 - 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NBY34_RS06130 (1295328) 1295328..1298474 - 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NBY34_RS06135 (1298497) 1298497..1299690 - 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T246762 WP_002892050.1 NZ_CP098165:c1294441-1294223 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT246762 WP_002892066.1 NZ_CP098165:c1294842-1294468 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References