Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 652327..653137 | Replicon | chromosome |
Accession | NZ_CP098165 | ||
Organism | Klebsiella pneumoniae strain Z0117KP0005 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | A0A060VJ83 |
Locus tag | NBY34_RS03040 | Protein ID | WP_004178461.1 |
Coordinates | 652604..653137 (+) | Length | 178 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | J2E9Q7 |
Locus tag | NBY34_RS03035 | Protein ID | WP_002887278.1 |
Coordinates | 652327..652593 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY34_RS03015 (648198) | 648198..648542 | - | 345 | WP_004894569.1 | cation efflux system protein CusF | - |
NBY34_RS03020 (648560) | 648560..649945 | - | 1386 | WP_026005908.1 | efflux transporter outer membrane subunit | - |
NBY34_RS03025 (650118) | 650118..650801 | + | 684 | WP_002887273.1 | copper response regulator transcription factor CusR | - |
NBY34_RS03030 (650791) | 650791..652224 | + | 1434 | WP_004186848.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
NBY34_RS03035 (652327) | 652327..652593 | + | 267 | WP_002887278.1 | type II toxin-antitoxin system antitoxin KacA | Antitoxin |
NBY34_RS03040 (652604) | 652604..653137 | + | 534 | WP_004178461.1 | type II toxin-antitoxin system toxin KacT | Toxin |
NBY34_RS03045 (653185) | 653185..654306 | - | 1122 | WP_004186850.1 | cupin domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19810.65 Da Isoelectric Point: 5.2614
>T246761 WP_004178461.1 NZ_CP098165:652604-653137 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A060VJ83 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 5ZGN | |
AlphaFold DB | A0A0H3GLZ1 |