Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 529229..529745 | Replicon | chromosome |
Accession | NZ_CP098165 | ||
Organism | Klebsiella pneumoniae strain Z0117KP0005 |
Toxin (Protein)
Gene name | relE | Uniprot ID | R4YAY3 |
Locus tag | NBY34_RS02515 | Protein ID | WP_004178374.1 |
Coordinates | 529461..529745 (+) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A919M0P8 |
Locus tag | NBY34_RS02510 | Protein ID | WP_032434351.1 |
Coordinates | 529229..529471 (+) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NBY34_RS02495 (525258) | 525258..525998 | + | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
NBY34_RS02500 (526064) | 526064..527218 | + | 1155 | WP_002886900.1 | lactonase family protein | - |
NBY34_RS02505 (527241) | 527241..529151 | + | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
NBY34_RS02510 (529229) | 529229..529471 | + | 243 | WP_032434351.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NBY34_RS02515 (529461) | 529461..529745 | + | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NBY34_RS02520 (529749) | 529749..530213 | - | 465 | WP_004222151.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NBY34_RS02525 (530455) | 530455..532593 | - | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NBY34_RS02530 (532950) | 532950..533693 | - | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
NBY34_RS02535 (533696) | 533696..533869 | - | 174 | WP_032414379.1 | hypothetical protein | - |
NBY34_RS02540 (533999) | 533999..534262 | + | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T246759 WP_004178374.1 NZ_CP098165:529461-529745 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|