Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 99994..100730 Replicon plasmid pZ0117KP0006-1
Accession NZ_CP098162
Organism Klebsiella pneumoniae strain Z0117KP0006

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag NBY36_RS26355 Protein ID WP_003026803.1
Coordinates 99994..100476 (-) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag NBY36_RS26360 Protein ID WP_003026799.1
Coordinates 100464..100730 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NBY36_RS26330 (NBY36_26330) 95069..95557 + 489 WP_004152114.1 phosphate-starvation-inducible PsiE family protein -
NBY36_RS26335 (NBY36_26335) 95544..96506 + 963 WP_004152113.1 zinc metalloprotease HtpX -
NBY36_RS26340 (NBY36_26340) 96683..97848 + 1166 Protein_104 IS3 family transposase -
NBY36_RS26345 (NBY36_26345) 97996..98391 - 396 WP_004143398.1 helix-turn-helix domain-containing protein -
NBY36_RS26350 (NBY36_26350) 98440..99786 - 1347 WP_077253535.1 ISNCY family transposase -
NBY36_RS26355 (NBY36_26355) 99994..100476 - 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
NBY36_RS26360 (NBY36_26360) 100464..100730 - 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
NBY36_RS26365 (NBY36_26365) 100906..101160 - 255 WP_004152108.1 hypothetical protein -
NBY36_RS26370 (NBY36_26370) 101236..101493 - 258 WP_004152107.1 hypothetical protein -
NBY36_RS26375 (NBY36_26375) 101542..101745 - 204 WP_004152106.1 HHA domain-containing protein -
NBY36_RS26380 (NBY36_26380) 101779..102147 - 369 WP_004152105.1 hypothetical protein -
NBY36_RS26385 (NBY36_26385) 102191..102685 - 495 WP_004152104.1 DNA-binding protein -
NBY36_RS26390 (NBY36_26390) 102716..103291 - 576 WP_004152103.1 hypothetical protein -
NBY36_RS26395 (NBY36_26395) 103279..103548 - 270 WP_004152102.1 hypothetical protein -
NBY36_RS26400 (NBY36_26400) 103906..104256 + 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
NBY36_RS26405 (NBY36_26405) 104306..104668 + 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid qnrB1 / tet(A) / blaOXA-1 / aac(6')-Ib-cr / aac(3)-IIa / dfrA14 / blaCTX-M-15 / blaTEM-1B / aph(6)-Id / aph(3'')-Ib / sul2 - 1..154763 154763


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T246756 WP_003026803.1 NZ_CP098162:c100476-99994 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT246756 WP_003026799.1 NZ_CP098162:c100730-100464 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References